Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   C6H98_RS08760 Genome accession   NZ_CP027221
Coordinates   1729585..1730169 (+) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli strain 2015C-3101     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1713330..1750742 1729585..1730169 within 0


Gene organization within MGE regions


Location: 1713330..1750742
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C6H98_RS08690 zapC 1714354..1714896 (+) 543 WP_001295353.1 cell division protein ZapC -
  C6H98_RS08695 ycbX 1714893..1716002 (-) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  C6H98_RS08700 rlmKL 1716246..1718354 (+) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  C6H98_RS08705 uup 1718366..1720273 (+) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  C6H98_RS08710 pqiA 1720403..1721656 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  C6H98_RS08715 pqiB 1721661..1723301 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  C6H98_RS08720 pqiC 1723298..1723861 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  C6H98_RS08725 rmf 1724117..1724284 (+) 168 WP_000828648.1 ribosome modulation factor -
  C6H98_RS08730 fabA 1724354..1724872 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  C6H98_RS08735 ycbZ 1724941..1726701 (-) 1761 WP_000156528.1 Lon protease family protein -
  C6H98_RS08740 matP 1726887..1727339 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  C6H98_RS08745 ompA 1727415..1728455 (-) 1041 WP_000750416.1 porin OmpA -
  C6H98_RS08755 sulA 1728812..1729321 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  C6H98_RS08760 sxy/tfoX 1729585..1730169 (+) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  C6H98_RS08765 yccS 1730132..1732294 (-) 2163 WP_000875023.1 YccS family putative transporter -
  C6H98_RS08770 yccF 1732304..1732750 (-) 447 WP_001261235.1 YccF domain-containing protein -
  C6H98_RS08775 helD 1732873..1734927 (+) 2055 WP_001297106.1 DNA helicase IV -
  C6H98_RS08780 mgsA 1734959..1735417 (-) 459 WP_000424181.1 methylglyoxal synthase -
  C6H98_RS08785 yccT 1735513..1736175 (-) 663 WP_000847791.1 DUF2057 family protein -
  C6H98_RS08790 yccU 1736348..1736761 (+) 414 WP_000665217.1 CoA-binding protein -
  C6H98_RS08795 hspQ 1736806..1737123 (-) 318 WP_001295356.1 heat shock protein HspQ -
  C6H98_RS08800 rlmI 1737181..1738371 (-) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  C6H98_RS08805 yccX 1738466..1738744 (+) 279 WP_000048244.1 acylphosphatase -
  C6H98_RS08810 tusE 1738741..1739070 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  C6H98_RS08815 yccA 1739161..1739820 (-) 660 WP_000375138.1 FtsH protease modulator YccA -
  C6H98_RS08820 - 1740228..1741243 (-) 1016 Protein_1612 tyrosine-type recombinase/integrase -
  C6H98_RS29150 - 1741221..1741463 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  C6H98_RS08825 - 1741531..1743998 (-) 2468 Protein_1614 3'-5' exoribonuclease -
  C6H98_RS08830 - 1744091..1744282 (-) 192 WP_001090200.1 DUF1482 family protein -
  C6H98_RS08835 dicB 1744279..1744467 (-) 189 WP_000449192.1 cell division inhibition protein DicB -
  C6H98_RS08845 - 1744999..1745373 (-) 375 WP_000394557.1 hypothetical protein -
  C6H98_RS08850 - 1745385..1745537 (-) 153 WP_000379580.1 DUF1391 family protein -
  C6H98_RS08860 - 1745809..1746525 (-) 717 WP_000103686.1 S24 family peptidase -
  C6H98_RS08865 - 1746575..1746790 (+) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  C6H98_RS08870 - 1746787..1747212 (+) 426 WP_000693949.1 toxin YdaT family protein -
  C6H98_RS08875 - 1747284..1748354 (+) 1071 WP_001262389.1 hypothetical protein -
  C6H98_RS08880 - 1748395..1748817 (+) 423 WP_001151153.1 DUF977 family protein -
  C6H98_RS08885 - 1748814..1749110 (+) 297 WP_001266135.1 DUF4406 domain-containing protein -
  C6H98_RS08890 - 1749107..1749568 (+) 462 WP_001209481.1 sigma-E factor regulatory protein RseB domain-containing protein -
  C6H98_RS08895 - 1749546..1749902 (+) 357 WP_000403777.1 hypothetical protein -
  C6H98_RS08900 - 1749953..1750165 (+) 213 WP_000935420.1 hypothetical protein -
  C6H98_RS08905 - 1750198..1750415 (+) 218 Protein_1628 DUF4014 family protein -
  C6H98_RS08910 - 1750417..1750680 (+) 264 WP_000224233.1 hypothetical protein -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=275839 C6H98_RS08760 WP_077825616.1 1729585..1730169(+) (sxy/tfoX) [Escherichia coli strain 2015C-3101]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=275839 C6H98_RS08760 WP_077825616.1 1729585..1730169(+) (sxy/tfoX) [Escherichia coli strain 2015C-3101]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(101-179)

TfoX N-terminal domain (TfoX_N)

(2-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995

Multiple sequence alignment