Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   D3Z87_RS17360 Genome accession   NZ_CP032310
Coordinates   3255477..3255644 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis strain WB800N     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250477..3260644
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D3Z87_RS17330 (D3Z87_17170) mrpE 3250872..3251348 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  D3Z87_RS17335 (D3Z87_17175) mrpF 3251348..3251632 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  D3Z87_RS17340 (D3Z87_17180) mnhG 3251616..3251990 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  D3Z87_RS17345 (D3Z87_17185) yuxO 3252029..3252409 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  D3Z87_RS17350 (D3Z87_17190) comA 3252428..3253072 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D3Z87_RS17355 (D3Z87_17195) comP 3253153..3255462 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  D3Z87_RS17360 (D3Z87_17200) comX 3255477..3255644 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  D3Z87_RS17365 (D3Z87_17205) comQ 3255632..3256531 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  D3Z87_RS17370 (D3Z87_17210) degQ 3256716..3256856 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D3Z87_RS17375 - 3257078..3257203 (+) 126 WP_003228793.1 hypothetical protein -
  D3Z87_RS17380 (D3Z87_17215) - 3257317..3257685 (+) 369 WP_003243784.1 hypothetical protein -
  D3Z87_RS17385 (D3Z87_17220) pdeH 3257661..3258890 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  D3Z87_RS17390 (D3Z87_17225) pncB 3259027..3260499 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=275556 D3Z87_RS17360 WP_003242801.1 3255477..3255644(-) (comX) [Bacillus subtilis strain WB800N]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=275556 D3Z87_RS17360 WP_003242801.1 3255477..3255644(-) (comX) [Bacillus subtilis strain WB800N]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment