Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   C1P71_RS15505 Genome accession   NZ_CP026831
Coordinates   2745011..2745640 (-) Length   209 a.a.
NCBI ID   WP_128880789.1    Uniprot ID   -
Organism   Shigella dysenteriae strain ATCC 12039     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2735844..2778210 2745011..2745640 within 0


Gene organization within MGE regions


Location: 2735844..2778210
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C1P71_RS15455 tusE 2736115..2736444 (+) 330 WP_128880787.1 sulfurtransferase TusE -
  C1P71_RS15460 yccX 2736441..2736719 (-) 279 WP_001550923.1 acylphosphatase -
  C1P71_RS15465 rlmI 2736814..2738004 (+) 1191 WP_000116263.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  C1P71_RS15470 hspQ 2738062..2738379 (+) 318 WP_001295356.1 heat shock protein HspQ -
  C1P71_RS15475 - 2738424..2738837 (-) 414 WP_128880788.1 CoA-binding protein -
  C1P71_RS15480 - 2739010..2739667 (+) 658 Protein_2760 DUF2057 family protein -
  C1P71_RS15485 mgsA 2739763..2740221 (+) 459 WP_000424181.1 methylglyoxal synthase -
  C1P71_RS15490 helD 2740253..2742307 (-) 2055 WP_128881633.1 DNA helicase IV -
  C1P71_RS15495 - 2742430..2742876 (+) 447 WP_001261235.1 YccF domain-containing protein -
  C1P71_RS15500 yccS 2742886..2745048 (+) 2163 WP_000875041.1 YccS family putative transporter -
  C1P71_RS15505 sxy/tfoX 2745011..2745640 (-) 630 WP_128880789.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  C1P71_RS15510 sulA 2745859..2746368 (+) 510 WP_128880790.1 SOS-induced cell division inhibitor SulA -
  C1P71_RS15515 ompA 2746725..2747759 (+) 1035 WP_128880791.1 porin OmpA -
  C1P71_RS15520 matP 2747835..2748287 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  C1P71_RS15525 - 2748473..2750233 (+) 1761 WP_128880792.1 Lon protease family protein -
  C1P71_RS15530 fabA 2750302..2750820 (+) 519 WP_089583590.1 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA -
  C1P71_RS15535 rmf 2750890..2751057 (-) 168 WP_000828648.1 ribosome modulation factor -
  C1P71_RS15540 pqiC 2751312..2751875 (-) 564 WP_128880793.1 membrane integrity-associated transporter subunit PqiC -
  C1P71_RS15545 pqiB 2751872..2753512 (-) 1641 WP_128880794.1 intermembrane transport protein PqiB -
  C1P71_RS15550 pqiA 2753517..2754770 (-) 1254 WP_128880795.1 membrane integrity-associated transporter subunit PqiA -
  C1P71_RS15555 - 2754900..2756807 (-) 1908 WP_128880796.1 ABC transporter ATP-binding protein -
  C1P71_RS15560 rlmKL 2756819..2758927 (-) 2109 WP_094308108.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  C1P71_RS15565 ycbX 2759171..2760280 (+) 1110 WP_128880797.1 6-N-hydroxylaminopurine resistance protein YcbX -
  C1P71_RS15570 zapC 2760277..2760819 (-) 543 WP_001295353.1 cell division protein ZapC -
  C1P71_RS15575 pyrD 2760993..2762003 (-) 1011 WP_001305914.1 quinone-dependent dihydroorotate dehydrogenase -
  C1P71_RS15580 - 2762114..2762851 (-) 738 WP_171766290.1 fimbrial chaperone -
  C1P71_RS15585 - 2762817..2763332 (-) 516 WP_000919478.1 fimbrial protein -
  C1P71_RS15590 - 2763340..2763882 (-) 543 WP_000730623.1 fimbrial protein -
  C1P71_RS15595 - 2763894..2764964 (-) 1071 WP_096990586.1 fimbrial protein -
  C1P71_RS15600 - 2764955..2765727 (-) 773 Protein_2784 fimbria/pilus outer membrane usher protein -
  C1P71_RS15605 - 2765789..2766633 (+) 845 WP_094096542.1 IS5-like element ISSfl7 family transposase -
  C1P71_RS15610 - 2766646..2768472 (-) 1827 Protein_2786 fimbrial biogenesis usher protein -
  C1P71_RS15615 - 2768497..2769027 (-) 531 Protein_2787 molecular chaperone -
  C1P71_RS15625 - 2770358..2770534 (-) 177 Protein_2789 fimbrial protein -
  C1P71_RS15630 - 2770617..2770694 (-) 78 Protein_2790 fimbrial protein -
  C1P71_RS15635 - 2770738..2771634 (-) 897 Protein_2791 IS3-like element IS600 family transposase -
  C1P71_RS15640 - 2771641..2772792 (-) 1152 WP_001254927.1 IS30-like element IS30 family transposase -
  C1P71_RS26985 - 2772789..2772875 (-) 87 Protein_2793 hypothetical protein -
  C1P71_RS15645 - 2772857..2773117 (-) 261 Protein_2794 transposase -
  C1P71_RS15650 - 2773182..2773574 (-) 393 Protein_2795 fimbrial protein -
  C1P71_RS15655 - 2773665..2774893 (+) 1229 WP_171766277.1 IS3-like element IS2 family transposase -
  C1P71_RS26990 - 2774905..2774982 (-) 78 Protein_2797 hypothetical protein -
  C1P71_RS15660 ssuE 2775334..2775909 (+) 576 WP_001263932.1 NADPH-dependent FMN reductase -
  C1P71_RS15665 ssuA 2775902..2776862 (+) 961 Protein_2799 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  C1P71_RS15670 ssuD 2776859..2778004 (+) 1146 WP_128880800.1 FMNH2-dependent alkanesulfonate monooxygenase -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24093.97 Da        Isoelectric Point: 8.8133

>NTDB_id=272845 C1P71_RS15505 WP_128880789.1 2745011..2745640(-) (sxy/tfoX) [Shigella dysenteriae strain ATCC 12039]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALCILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=272845 C1P71_RS15505 WP_128880789.1 2745011..2745640(-) (sxy/tfoX) [Shigella dysenteriae strain ATCC 12039]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGTAGTTATAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTTTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTATGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGGGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(116-194)

TfoX N-terminal domain (TfoX_N)

(14-106)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995

Multiple sequence alignment