Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   C1P82_RS13480 Genome accession   NZ_CP026799
Coordinates   2606925..2607176 (-) Length   83 a.a.
NCBI ID   WP_073705626.1    Uniprot ID   A0A4P7TN66
Organism   Shigella flexneri strain NCTC 9728     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2597753..2638285 2606925..2607176 within 0
IScluster/Tn 2607161..2608389 2606925..2607176 flank -15


Gene organization within MGE regions


Location: 2597753..2638285
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C1P82_RS13430 tusE 2598024..2598353 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  C1P82_RS13435 yccX 2598350..2598628 (-) 279 WP_000048219.1 acylphosphatase -
  C1P82_RS13440 rlmI 2598723..2599913 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  C1P82_RS13445 hspQ 2599971..2600288 (+) 318 WP_001295356.1 heat shock protein HspQ -
  C1P82_RS13450 - 2600333..2600746 (-) 414 WP_000665217.1 CoA-binding protein -
  C1P82_RS13455 - 2600919..2601581 (+) 663 WP_000847779.1 DUF2057 family protein -
  C1P82_RS13460 mgsA 2601677..2602135 (+) 459 WP_000424181.1 methylglyoxal synthase -
  C1P82_RS13465 helD 2602167..2604221 (-) 2055 WP_024260251.1 DNA helicase IV -
  C1P82_RS13470 - 2604344..2604790 (+) 447 WP_001261235.1 YccF domain-containing protein -
  C1P82_RS13475 yccS 2604800..2606962 (+) 2163 WP_134807649.1 YccS family putative transporter -
  C1P82_RS13480 sxy/tfoX 2606925..2607176 (-) 252 WP_073705626.1 TfoX/Sxy family protein Regulator
  C1P82_RS13490 sxy 2608480..2608890 (-) 411 Protein_2613 CRP-S regulon transcriptional coactivator Sxy -
  C1P82_RS13495 sulA 2609109..2609618 (+) 510 WP_000288715.1 SOS-induced cell division inhibitor SulA -
  C1P82_RS13500 ompA 2609974..2611020 (+) 1047 WP_005105223.1 porin OmpA -
  C1P82_RS13505 matP 2611096..2611548 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  C1P82_RS13510 - 2611733..2613493 (+) 1761 WP_000156489.1 Lon protease family protein -
  C1P82_RS13515 fabA 2613562..2614080 (+) 519 WP_005047466.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  C1P82_RS13520 rmf 2614150..2614317 (-) 168 WP_011110566.1 ribosome modulation factor -
  C1P82_RS13525 pqiC 2614573..2615136 (-) 564 WP_134807650.1 membrane integrity-associated transporter subunit PqiC -
  C1P82_RS13530 pqiB 2615133..2616773 (-) 1641 WP_000445541.1 intermembrane transport protein PqiB -
  C1P82_RS13535 pqiA 2616778..2618031 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  C1P82_RS13540 - 2618161..2620068 (-) 1908 WP_000053059.1 ABC transporter ATP-binding protein -
  C1P82_RS13545 rlmKL 2620080..2622188 (-) 2109 WP_001086554.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  C1P82_RS13550 ycbX 2622432..2623541 (+) 1110 WP_000224274.1 6-N-hydroxylaminopurine resistance protein YcbX -
  C1P82_RS13555 zapC 2623538..2624080 (-) 543 WP_004991542.1 cell division protein ZapC -
  C1P82_RS13560 pyrD 2624254..2625264 (-) 1011 WP_001370288.1 quinone-dependent dihydroorotate dehydrogenase -
  C1P82_RS13565 - 2625375..2626111 (-) 737 Protein_2628 fimbrial chaperone -
  C1P82_RS13570 - 2626077..2626592 (-) 516 WP_000919489.1 fimbrial protein -
  C1P82_RS13575 - 2626600..2627142 (-) 543 WP_000730630.1 fimbrial protein -
  C1P82_RS13580 - 2627154..2628223 (-) 1070 Protein_2631 fimbrial protein -
  C1P82_RS13585 - 2628214..2630814 (-) 2601 WP_000286330.1 fimbrial biogenesis usher protein -
  C1P82_RS13590 - 2630839..2631540 (-) 702 WP_005105220.1 molecular chaperone -
  C1P82_RS13595 - 2631623..2631721 (-) 99 Protein_2634 fimbrial protein -
  C1P82_RS13600 - 2631790..2632487 (+) 698 WP_223368647.1 IS1 family transposase -
  C1P82_RS13605 - 2632785..2633246 (+) 462 WP_000750299.1 fimbrial protein -
  C1P82_RS13615 ssuE 2634075..2634650 (+) 576 WP_001263929.1 NADPH-dependent FMN reductase -
  C1P82_RS13620 ssuA 2634643..2635602 (+) 960 WP_001244322.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  C1P82_RS13625 ssuD 2635599..2636744 (+) 1146 WP_000056001.1 FMNH2-dependent alkanesulfonate monooxygenase -
  C1P82_RS13630 - 2636756..2636935 (+) 180 Protein_2641 hypothetical protein -
  C1P82_RS13635 - 2637027..2638255 (+) 1229 WP_094081542.1 IS3-like element IS2 family transposase -

Sequence

Protein


Download         Length: 83 a.a.        Molecular weight: 9234.86 Da        Isoelectric Point: 6.9794

>NTDB_id=272624 C1P82_RS13480 WP_073705626.1 2606925..2607176(-) (sxy/tfoX) [Shigella flexneri strain NCTC 9728]
MPGNIGANPVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPA
ELE

Nucleotide


Download         Length: 252 bp        

>NTDB_id=272624 C1P82_RS13480 WP_073705626.1 2606925..2607176(-) (sxy/tfoX) [Shigella flexneri strain NCTC 9728]
ATGCCTGGAAATATAGGGGCAAATCCAGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTG
GTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATG
AAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCG
GAGCTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(10-68)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A4P7TN66

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

89.157

0.892

Multiple sequence alignment