Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   C2I25_RS26725 Genome accession   NZ_CP026678
Coordinates   5041173..5041451 (-) Length   92 a.a.
NCBI ID   WP_106824982.1    Uniprot ID   -
Organism   Bacillus cereus strain TG1-6     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 5011311..5052513 5041173..5041451 within 0


Gene organization within MGE regions


Location: 5011311..5052513
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2I25_RS26555 (C2I25_26535) - 5011311..5012243 (-) 933 WP_106824962.1 N-acetylmuramoyl-L-alanine amidase -
  C2I25_RS26560 (C2I25_26540) - 5012243..5012668 (-) 426 WP_061139235.1 holin family protein -
  C2I25_RS26565 (C2I25_26545) - 5012708..5015437 (-) 2730 WP_106824963.1 phage tail spike protein -
  C2I25_RS26570 (C2I25_26550) - 5015434..5016120 (-) 687 WP_106824964.1 phage tail protein -
  C2I25_RS26575 (C2I25_26555) - 5016113..5019961 (-) 3849 WP_106824965.1 phage tail tape measure protein -
  C2I25_RS26580 (C2I25_26560) - 5020144..5020509 (-) 366 WP_106824966.1 hypothetical protein -
  C2I25_RS26585 (C2I25_26565) - 5020585..5021148 (-) 564 WP_106824967.1 phage tail protein -
  C2I25_RS26590 (C2I25_26570) - 5021150..5021560 (-) 411 WP_106824968.1 hypothetical protein -
  C2I25_RS26595 (C2I25_26575) - 5021550..5021930 (-) 381 WP_106824969.1 hypothetical protein -
  C2I25_RS26600 (C2I25_26580) - 5021917..5022273 (-) 357 WP_106824970.1 phage head-tail adapter protein -
  C2I25_RS26605 (C2I25_26585) - 5022263..5022586 (-) 324 WP_106824971.1 hypothetical protein -
  C2I25_RS26610 (C2I25_26590) - 5022600..5023721 (-) 1122 WP_106824972.1 phage major capsid protein -
  C2I25_RS26615 (C2I25_26595) - 5023737..5024441 (-) 705 WP_317615612.1 head maturation protease, ClpP-related -
  C2I25_RS26620 (C2I25_26600) - 5024383..5025624 (-) 1242 WP_106824973.1 phage portal protein -
  C2I25_RS26625 (C2I25_26605) - 5025641..5027317 (-) 1677 WP_406741364.1 terminase TerL endonuclease subunit -
  C2I25_RS26630 (C2I25_26610) - 5027295..5027795 (-) 501 WP_106824975.1 P27 family phage terminase small subunit -
  C2I25_RS26635 (C2I25_26615) - 5028105..5028371 (-) 267 WP_097966290.1 hypothetical protein -
  C2I25_RS26640 (C2I25_26620) - 5028416..5028745 (-) 330 WP_097966229.1 HNH endonuclease -
  C2I25_RS26645 (C2I25_26625) - 5028742..5028963 (-) 222 WP_097966231.1 hypothetical protein -
  C2I25_RS26655 (C2I25_26635) - 5029343..5029996 (-) 654 WP_106824976.1 hypothetical protein -
  C2I25_RS26660 (C2I25_26640) - 5030350..5031519 (-) 1170 WP_016081850.1 serine hydrolase -
  C2I25_RS26665 (C2I25_26645) - 5032330..5033280 (-) 951 WP_053564380.1 nucleoside hydrolase -
  C2I25_RS26670 (C2I25_26650) - 5033494..5034036 (-) 543 WP_106824977.1 site-specific integrase -
  C2I25_RS26675 (C2I25_26655) - 5034036..5034518 (-) 483 WP_106824978.1 ArpU family phage packaging/lysis transcriptional regulator -
  C2I25_RS28995 (C2I25_26660) - 5034546..5034716 (-) 171 WP_080469791.1 hypothetical protein -
  C2I25_RS26685 (C2I25_26665) - 5034875..5035531 (-) 657 WP_106824979.1 DUF6944 family repetitive protein -
  C2I25_RS26690 (C2I25_26670) - 5037056..5037784 (+) 729 WP_262984025.1 glycosyltransferase family 2 protein -
  C2I25_RS26695 (C2I25_26675) - 5038757..5039356 (+) 600 WP_063547387.1 undecaprenyl-diphosphatase -
  C2I25_RS26700 (C2I25_26680) - 5039467..5039721 (-) 255 WP_050822240.1 hypothetical protein -
  C2I25_RS26705 (C2I25_26685) - 5039883..5040338 (-) 456 WP_076775055.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  C2I25_RS26710 (C2I25_26690) - 5040358..5040609 (-) 252 WP_106824981.1 helix-turn-helix domain containing protein -
  C2I25_RS26715 (C2I25_26695) - 5040635..5040802 (-) 168 WP_000717828.1 DUF3954 domain-containing protein -
  C2I25_RS26720 (C2I25_26700) - 5040821..5041180 (-) 360 WP_098277274.1 cell division protein SepF -
  C2I25_RS26725 (C2I25_26705) abrB 5041173..5041451 (-) 279 WP_106824982.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  C2I25_RS26730 (C2I25_26710) - 5041455..5042366 (-) 912 WP_106824983.1 DnaD domain protein -
  C2I25_RS26735 (C2I25_26715) - 5042644..5042919 (-) 276 WP_098691158.1 helix-turn-helix domain-containing protein -
  C2I25_RS26740 (C2I25_26720) - 5043178..5043420 (-) 243 WP_106824984.1 helix-turn-helix domain-containing protein -
  C2I25_RS26745 (C2I25_26725) - 5043646..5043990 (+) 345 WP_106824985.1 helix-turn-helix domain-containing protein -
  C2I25_RS29000 - 5044257..5044409 (-) 153 WP_180230519.1 hypothetical protein -
  C2I25_RS26750 (C2I25_26730) - 5044442..5045584 (-) 1143 WP_106824986.1 AimR family lysis-lysogeny pheromone receptor -
  C2I25_RS26755 (C2I25_26735) - 5046144..5047460 (-) 1317 WP_106824987.1 hypothetical protein -
  C2I25_RS26760 (C2I25_26740) - 5047626..5048087 (-) 462 WP_098855212.1 hypothetical protein -
  C2I25_RS26765 (C2I25_26745) - 5048321..5049430 (+) 1110 WP_106824988.1 tyrosine-type recombinase/integrase -
  C2I25_RS26770 (C2I25_26750) - 5049469..5050170 (-) 702 WP_106824989.1 pPIWI_RE module domain-containing protein -
  C2I25_RS26775 (C2I25_26755) - 5050482..5050967 (-) 486 WP_106824990.1 homoserine dehydrogenase -
  C2I25_RS29005 - 5051177..5051308 (-) 132 Protein_5038 site-specific integrase -
  C2I25_RS26780 (C2I25_26760) - 5051451..5051780 (-) 330 WP_048564718.1 heterocycloanthracin/sonorensin family bacteriocin -
  C2I25_RS26785 (C2I25_26765) - 5052250..5052513 (-) 264 WP_002082716.1 DUF3937 domain-containing protein -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10115.80 Da        Isoelectric Point: 7.1669

>NTDB_id=271683 C2I25_RS26725 WP_106824982.1 5041173..5041451(-) (abrB) [Bacillus cereus strain TG1-6]
MKNTGVARKVDELGRVVIPVELRRTLGIVKGTALDFHVDGESIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGTIEL
LDLIQKSGMAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=271683 C2I25_RS26725 WP_106824982.1 5041173..5041451(-) (abrB) [Bacillus cereus strain TG1-6]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCAAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAGCATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGACAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

58.621

94.565

0.554

Multiple sequence alignment