Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   BL14DL4_RS09460 Genome accession   NZ_CP026673
Coordinates   1721432..1721716 (-) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain 14ADL4     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1675034..1726587 1721432..1721716 within 0


Gene organization within MGE regions


Location: 1675034..1726587
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BL14DL4_RS09160 (BL14DL4_01832) - 1675034..1675681 (-) 648 WP_025807650.1 Panacea domain-containing protein -
  BL14DL4_RS09165 (BL14DL4_01833) - 1675931..1676161 (-) 231 WP_025807652.1 helix-turn-helix domain-containing protein -
  BL14DL4_RS22875 (BL14DL4_01834) - 1676416..1676559 (-) 144 WP_021837703.1 hypothetical protein -
  BL14DL4_RS09175 (BL14DL4_01835) - 1676752..1678368 (+) 1617 WP_025807654.1 ribonuclease YeeF family protein -
  BL14DL4_RS09180 (BL14DL4_01836) - 1678381..1678797 (+) 417 WP_006637262.1 immunity 70 family protein -
  BL14DL4_RS09185 (BL14DL4_01837) - 1678828..1679772 (-) 945 WP_025807656.1 glycoside hydrolase family 25 protein -
  BL14DL4_RS09190 (BL14DL4_01838) - 1679820..1680083 (-) 264 WP_061578561.1 phage holin -
  BL14DL4_RS09195 (BL14DL4_01839) - 1680099..1680368 (-) 270 WP_061578562.1 hemolysin XhlA family protein -
  BL14DL4_RS09200 (BL14DL4_01840) - 1680431..1680616 (-) 186 WP_017474870.1 XkdX family protein -
  BL14DL4_RS09205 (BL14DL4_01841) - 1680613..1680927 (-) 315 WP_025808190.1 hypothetical protein -
  BL14DL4_RS09210 (BL14DL4_01842) - 1680939..1682303 (-) 1365 WP_095266825.1 phage baseplate upper protein -
  BL14DL4_RS09215 (BL14DL4_01843) - 1682324..1684279 (-) 1956 WP_095266827.1 right-handed parallel beta-helix repeat-containing protein -
  BL14DL4_RS09220 (BL14DL4_01844) - 1684315..1686027 (-) 1713 WP_017474878.1 phage tail protein -
  BL14DL4_RS09225 (BL14DL4_01845) - 1686040..1686876 (-) 837 WP_017474879.1 phage tail family protein -
  BL14DL4_RS09230 (BL14DL4_01846) - 1686876..1691345 (-) 4470 WP_017474880.1 phage tail tape measure protein -
  BL14DL4_RS09235 (BL14DL4_01848) gpG 1691554..1691916 (-) 363 WP_003185339.1 phage tail assembly chaperone G -
  BL14DL4_RS09240 (BL14DL4_01849) - 1691970..1692587 (-) 618 WP_003185341.1 major tail protein -
  BL14DL4_RS09245 (BL14DL4_01850) - 1692602..1692985 (-) 384 WP_003185344.1 hypothetical protein -
  BL14DL4_RS09250 (BL14DL4_01851) - 1692982..1693380 (-) 399 WP_006637249.1 HK97-gp10 family putative phage morphogenesis protein -
  BL14DL4_RS09255 (BL14DL4_01852) - 1693380..1693688 (-) 309 WP_003185349.1 phage head closure protein -
  BL14DL4_RS09260 (BL14DL4_01853) - 1693678..1693980 (-) 303 WP_003185351.1 head-tail connector protein -
  BL14DL4_RS09265 (BL14DL4_01854) - 1694001..1694426 (-) 426 WP_003185353.1 collagen-like protein -
  BL14DL4_RS09270 (BL14DL4_01855) - 1694450..1695733 (-) 1284 WP_025807602.1 phage major capsid protein -
  BL14DL4_RS09275 (BL14DL4_01856) - 1695772..1696503 (-) 732 WP_035317290.1 head maturation protease, ClpP-related -
  BL14DL4_RS09280 (BL14DL4_01857) - 1696448..1697758 (-) 1311 WP_025807606.1 phage portal protein -
  BL14DL4_RS09285 (BL14DL4_01858) - 1697759..1697950 (-) 192 WP_025807608.1 DUF1056 family protein -
  BL14DL4_RS09290 (BL14DL4_01859) - 1697962..1699671 (-) 1710 WP_105179760.1 terminase large subunit -
  BL14DL4_RS09295 (BL14DL4_01860) - 1699668..1700183 (-) 516 WP_025807612.1 phage terminase small subunit P27 family -
  BL14DL4_RS09300 (BL14DL4_01861) - 1700413..1700787 (-) 375 WP_021837717.1 HNH endonuclease -
  BL14DL4_RS09305 (BL14DL4_01862) - 1700814..1701122 (-) 309 WP_095266831.1 hypothetical protein -
  BL14DL4_RS09310 (BL14DL4_01863) - 1701296..1701637 (-) 342 WP_095266833.1 hypothetical protein -
  BL14DL4_RS09315 (BL14DL4_01864) - 1701722..1702345 (-) 624 WP_095266835.1 hypothetical protein -
  BL14DL4_RS09320 (BL14DL4_01865) cotD 1702590..1702814 (-) 225 WP_003185368.1 spore coat protein CotD -
  BL14DL4_RS09325 (BL14DL4_01866) - 1703565..1703945 (-) 381 WP_009329244.1 ArpU family phage packaging/lysis transcriptional regulator -
  BL14DL4_RS09330 (BL14DL4_01868) - 1704058..1704435 (-) 378 WP_025807623.1 YopX family protein -
  BL14DL4_RS09335 (BL14DL4_01869) - 1704451..1704972 (-) 522 WP_234013691.1 putative metallopeptidase -
  BL14DL4_RS09340 (BL14DL4_01870) - 1704969..1705139 (-) 171 WP_071583658.1 Fur-regulated basic protein FbpA -
  BL14DL4_RS09345 (BL14DL4_01871) - 1705136..1705675 (-) 540 WP_025807627.1 ERCC4 domain-containing protein -
  BL14DL4_RS09350 (BL14DL4_01872) - 1705672..1706109 (-) 438 WP_025807629.1 hypothetical protein -
  BL14DL4_RS09355 (BL14DL4_01873) - 1706087..1706350 (-) 264 WP_025807631.1 hypothetical protein -
  BL14DL4_RS09360 (BL14DL4_01874) - 1706626..1709058 (-) 2433 WP_095266837.1 phage/plasmid primase, P4 family -
  BL14DL4_RS09365 (BL14DL4_01875) - 1709119..1709556 (-) 438 WP_095266839.1 DUF669 domain-containing protein -
  BL14DL4_RS09370 (BL14DL4_01876) - 1709556..1710488 (-) 933 WP_011198320.1 AAA family ATPase -
  BL14DL4_RS09375 (BL14DL4_01877) - 1710492..1711049 (-) 558 WP_021837730.1 host-nuclease inhibitor Gam family protein -
  BL14DL4_RS09380 (BL14DL4_01878) - 1711142..1711384 (-) 243 WP_011198322.1 hypothetical protein -
  BL14DL4_RS09385 (BL14DL4_01880) - 1711472..1711738 (-) 267 WP_021837731.1 YqaH family protein -
  BL14DL4_RS09390 (BL14DL4_01881) - 1711801..1712130 (+) 330 WP_021837732.1 hypothetical protein -
  BL14DL4_RS22670 (BL14DL4_01882) - 1712127..1712285 (-) 159 WP_021837733.1 hypothetical protein -
  BL14DL4_RS09395 (BL14DL4_01884) - 1712411..1712965 (-) 555 WP_003185401.1 hypothetical protein -
  BL14DL4_RS09400 (BL14DL4_01885) - 1713023..1713211 (-) 189 WP_016886536.1 hypothetical protein -
  BL14DL4_RS09405 - 1713343..1713531 (-) 189 WP_003185403.1 helix-turn-helix transcriptional regulator -
  BL14DL4_RS09410 (BL14DL4_01886) - 1713528..1714322 (-) 795 WP_035317292.1 ORF6N domain-containing protein -
  BL14DL4_RS09420 (BL14DL4_01887) - 1714431..1714664 (-) 234 WP_025807640.1 helix-turn-helix transcriptional regulator -
  BL14DL4_RS09425 (BL14DL4_01888) - 1714830..1715525 (+) 696 WP_025807642.1 XRE family transcriptional regulator -
  BL14DL4_RS09430 (BL14DL4_01889) - 1715596..1716690 (+) 1095 WP_025807644.1 tyrosine-type recombinase/integrase -
  BL14DL4_RS09440 (BL14DL4_01890) smpB 1717242..1717715 (-) 474 WP_009329604.1 SsrA-binding protein SmpB -
  BL14DL4_RS09445 (BL14DL4_01891) rnr 1717827..1720130 (-) 2304 WP_003185414.1 ribonuclease R -
  BL14DL4_RS09450 (BL14DL4_01892) - 1720144..1720890 (-) 747 WP_003185416.1 alpha/beta hydrolase -
  BL14DL4_RS09455 (BL14DL4_01893) secG 1721031..1721261 (-) 231 WP_003185418.1 preprotein translocase subunit SecG -
  BL14DL4_RS09460 (BL14DL4_01894) abrB 1721432..1721716 (-) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  BL14DL4_RS09465 (BL14DL4_01895) - 1721745..1721978 (-) 234 WP_085959538.1 helix-turn-helix domain-containing protein -
  BL14DL4_RS09470 (BL14DL4_01896) - 1722131..1722532 (+) 402 WP_009329609.1 transcriptional regulator -
  BL14DL4_RS09475 (BL14DL4_01897) - 1722702..1723100 (+) 399 WP_009329610.1 helix-turn-helix domain-containing protein -
  BL14DL4_RS09480 (BL14DL4_01898) - 1723148..1723825 (-) 678 WP_003185432.1 ABC transporter permease -
  BL14DL4_RS09485 (BL14DL4_01899) opuCC 1723842..1724759 (-) 918 WP_009329611.1 osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC -
  BL14DL4_RS09490 (BL14DL4_01900) - 1724773..1725426 (-) 654 WP_009329612.1 ABC transporter permease -
  BL14DL4_RS09495 (BL14DL4_01901) - 1725448..1726587 (-) 1140 WP_003185439.1 betaine/proline/choline family ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=271517 BL14DL4_RS09460 WP_003185421.1 1721432..1721716(-) (abrB) [Bacillus licheniformis strain 14ADL4]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=271517 BL14DL4_RS09460 WP_003185421.1 1721432..1721716(-) (abrB) [Bacillus licheniformis strain 14ADL4]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543

Multiple sequence alignment