Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BL14DL4_RS08065 Genome accession   NZ_CP026673
Coordinates   1459450..1459590 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain 14ADL4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1454450..1464590
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BL14DL4_RS08040 (BL14DL4_01606) - 1454747..1455136 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  BL14DL4_RS08045 (BL14DL4_01607) comA 1455153..1455791 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  BL14DL4_RS08050 (BL14DL4_01608) comP 1455878..1458184 (-) 2307 WP_025807478.1 ATP-binding protein Regulator
  BL14DL4_RS08055 (BL14DL4_01609) comX 1458207..1458371 (-) 165 WP_003184853.1 competence pheromone ComX -
  BL14DL4_RS08060 (BL14DL4_01610) - 1458380..1459261 (-) 882 WP_003184856.1 polyprenyl synthetase family protein -
  BL14DL4_RS08065 (BL14DL4_01611) degQ 1459450..1459590 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  BL14DL4_RS08075 (BL14DL4_01613) - 1460076..1460423 (+) 348 WP_009329512.1 hypothetical protein -
  BL14DL4_RS08080 (BL14DL4_01614) - 1460466..1461686 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  BL14DL4_RS08085 (BL14DL4_01615) - 1461865..1463334 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  BL14DL4_RS08090 (BL14DL4_01616) - 1463352..1463903 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  BL14DL4_RS08095 (BL14DL4_01617) - 1464088..1464489 (-) 402 WP_003184870.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=271514 BL14DL4_RS08065 WP_003184860.1 1459450..1459590(-) (degQ) [Bacillus licheniformis strain 14ADL4]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=271514 BL14DL4_RS08065 WP_003184860.1 1459450..1459590(-) (degQ) [Bacillus licheniformis strain 14ADL4]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P69890

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment