Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BL14DL4_RS04235 Genome accession   NZ_CP026673
Coordinates   755343..755519 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain 14ADL4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 750343..760519
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BL14DL4_RS04220 (BL14DL4_00851) gcvT 750985..752079 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  BL14DL4_RS04225 (BL14DL4_00852) - 752672..754351 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  BL14DL4_RS04230 (BL14DL4_00853) - 754358..755152 (+) 795 WP_003183441.1 YqhG family protein -
  BL14DL4_RS04235 (BL14DL4_00854) sinI 755343..755519 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  BL14DL4_RS04240 (BL14DL4_00855) sinR 755553..755888 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  BL14DL4_RS04245 (BL14DL4_00856) tasA 755993..756787 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  BL14DL4_RS04250 (BL14DL4_00857) sipW 756861..757445 (-) 585 WP_003183449.1 signal peptidase I SipW -
  BL14DL4_RS04255 (BL14DL4_00858) tapA 757442..758170 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  BL14DL4_RS04260 (BL14DL4_00859) - 758447..758767 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  BL14DL4_RS04265 (BL14DL4_00860) - 758791..758973 (-) 183 WP_003183456.1 YqzE family protein -
  BL14DL4_RS04270 (BL14DL4_00861) comGG 759062..759427 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  BL14DL4_RS04275 (BL14DL4_00862) comGF 759440..759928 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  BL14DL4_RS04280 comGE 759837..760184 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=271497 BL14DL4_RS04235 WP_003183444.1 755343..755519(+) (sinI) [Bacillus licheniformis strain 14ADL4]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=271497 BL14DL4_RS04235 WP_003183444.1 755343..755519(+) (sinI) [Bacillus licheniformis strain 14ADL4]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517


Multiple sequence alignment