Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   BV11031_RS16470 Genome accession   NZ_CP026362
Coordinates   3105769..3105891 (-) Length   40 a.a.
NCBI ID   WP_010330797.1    Uniprot ID   A0AAP3CHT3
Organism   Bacillus vallismortis strain DSM 11031     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 3100769..3110891
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BV11031_RS16440 (BV11031_16415) yclP 3100779..3101537 (-) 759 WP_010330802.1 petrobactin ABC transporter ATP-binding protein YclP -
  BV11031_RS16445 (BV11031_16420) yclO 3101531..3102478 (-) 948 WP_010330801.1 petrobactin ABC transporter permease YclO -
  BV11031_RS16450 (BV11031_16425) ceuB 3102471..3103421 (-) 951 WP_010330800.1 petrobactin ABC transporter permease YclN Machinery gene
  BV11031_RS16455 (BV11031_16430) - 3103809..3105173 (+) 1365 WP_010330799.1 aspartate kinase -
  BV11031_RS16460 (BV11031_16435) - 3105326..3105439 (+) 114 WP_010330798.1 YjcZ family sporulation protein -
  BV11031_RS16465 (BV11031_16440) - 3105576..3105671 (+) 96 WP_026014550.1 YjcZ family sporulation protein -
  BV11031_RS16470 (BV11031_16445) phrC 3105769..3105891 (-) 123 WP_010330797.1 phosphatase RapC inhibitor PhrC Regulator
  BV11031_RS16475 (BV11031_16450) rapC 3105875..3107023 (-) 1149 WP_010330796.1 response regulator aspartate phosphatase RapC Regulator
  BV11031_RS16480 (BV11031_16455) - 3107186..3108601 (-) 1416 WP_082246392.1 HAMP domain-containing sensor histidine kinase -
  BV11031_RS16485 (BV11031_16460) yclJ 3108588..3109271 (-) 684 WP_010330794.1 two-component system response regulator YclJ -

Sequence

Protein


Download         Length: 40 a.a.        Molecular weight: 4151.91 Da        Isoelectric Point: 8.0285

>NTDB_id=268850 BV11031_RS16470 WP_010330797.1 3105769..3105891(-) (phrC) [Bacillus vallismortis strain DSM 11031]
MKLKSKLFVICLAAAAIFTAAGVSANAEAPDFHVAERGMT

Nucleotide


Download         Length: 123 bp        

>NTDB_id=268850 BV11031_RS16470 WP_010330797.1 3105769..3105891(-) (phrC) [Bacillus vallismortis strain DSM 11031]
ATGAAATTGAAATCTAAGTTGTTTGTTATTTGTTTAGCCGCAGCTGCGATTTTTACAGCAGCCGGCGTCTCTGCTAACGC
GGAAGCACCCGACTTTCATGTGGCGGAAAGAGGAATGACATAA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-40)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

95

100

0.95

Multiple sequence alignment