Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C2I05_RS06070 Genome accession   NZ_CP026039
Coordinates   1094230..1094370 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PK1_2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1089230..1099370
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2I05_RS06045 (C2I05_06020) yuxO 1089572..1089952 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  C2I05_RS06050 (C2I05_06025) comA 1089971..1090615 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C2I05_RS06055 (C2I05_06030) comP 1090696..1092996 (-) 2301 WP_120028527.1 histidine kinase Regulator
  C2I05_RS06060 (C2I05_06035) comX 1093008..1093172 (-) 165 WP_015384519.1 competence pheromone ComX -
  C2I05_RS06065 (C2I05_06040) - 1093185..1094045 (-) 861 WP_064671628.1 polyprenyl synthetase family protein -
  C2I05_RS06070 (C2I05_06045) degQ 1094230..1094370 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C2I05_RS06075 - 1094592..1094717 (+) 126 WP_120028613.1 hypothetical protein -
  C2I05_RS06080 (C2I05_06050) - 1094832..1095200 (+) 369 WP_038828672.1 hypothetical protein -
  C2I05_RS06085 (C2I05_06055) pdeH 1095176..1096405 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  C2I05_RS06090 (C2I05_06060) pncB 1096542..1098014 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C2I05_RS06095 (C2I05_06065) pncA 1098030..1098581 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  C2I05_RS06100 (C2I05_06070) yueI 1098678..1099076 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=265843 C2I05_RS06070 WP_003220708.1 1094230..1094370(-) (degQ) [Bacillus subtilis strain PK1_2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=265843 C2I05_RS06070 WP_003220708.1 1094230..1094370(-) (degQ) [Bacillus subtilis strain PK1_2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment