Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BS11774_RS00570 Genome accession   NZ_CP026010
Coordinates   96011..96151 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain ATCC 11774     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 91011..101151
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BS11774_RS00540 (BS11774_00535) - 91100..92788 (-) 1689 Protein_81 histidine kinase -
  BS11774_RS00545 (BS11774_00540) - 92813..94060 (-) 1248 WP_031600262.1 IS256-like element ISBsu2 family transposase -
  BS11774_RS00555 (BS11774_00550) - 94157..94777 (-) 621 Protein_83 PDZ domain-containing protein -
  BS11774_RS00560 (BS11774_00555) comX 94789..94953 (-) 165 WP_015384519.1 competence pheromone ComX -
  BS11774_RS00565 (BS11774_00560) - 94966..95826 (-) 861 WP_128422373.1 polyprenyl synthetase family protein -
  BS11774_RS00570 (BS11774_00565) degQ 96011..96151 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BS11774_RS00575 - 96373..96498 (+) 126 WP_128473219.1 hypothetical protein -
  BS11774_RS00580 (BS11774_00570) - 96614..96982 (+) 369 WP_017695529.1 hypothetical protein -
  BS11774_RS00585 (BS11774_00575) pdeH 96958..98187 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  BS11774_RS00590 (BS11774_00580) pncB 98324..99796 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BS11774_RS00595 (BS11774_00585) pncA 99812..100363 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  BS11774_RS00600 (BS11774_00590) yueI 100460..100858 (-) 399 WP_017695530.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=264949 BS11774_RS00570 WP_003220708.1 96011..96151(-) (degQ) [Bacillus subtilis strain ATCC 11774]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=264949 BS11774_RS00570 WP_003220708.1 96011..96151(-) (degQ) [Bacillus subtilis strain ATCC 11774]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment