Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C0W57_RS13420 Genome accession   NZ_CP025939
Coordinates   2599861..2600001 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 10075     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2594861..2605001
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C0W57_RS13395 (C0W57_13395) - 2595203..2595586 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  C0W57_RS13400 (C0W57_13400) comA 2595608..2596252 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  C0W57_RS13405 (C0W57_13405) comP 2596333..2598624 (-) 2292 WP_029973797.1 histidine kinase Regulator
  C0W57_RS13410 (C0W57_13410) comX 2598636..2598800 (-) 165 WP_007613432.1 competence pheromone ComX -
  C0W57_RS13415 (C0W57_13415) - 2598800..2599710 (-) 911 Protein_2638 polyprenyl synthetase family protein -
  C0W57_RS13420 (C0W57_13420) degQ 2599861..2600001 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  C0W57_RS13430 (C0W57_13430) - 2600467..2600808 (+) 342 WP_014418765.1 hypothetical protein -
  C0W57_RS13435 (C0W57_13435) - 2600815..2602038 (-) 1224 WP_029973798.1 EAL and HDOD domain-containing protein -
  C0W57_RS13440 (C0W57_13440) - 2602168..2603634 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  C0W57_RS13445 (C0W57_13445) - 2603652..2604203 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  C0W57_RS13450 (C0W57_13450) - 2604300..2604698 (-) 399 WP_029973800.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=264641 C0W57_RS13420 WP_003152043.1 2599861..2600001(-) (degQ) [Bacillus velezensis strain 10075]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=264641 C0W57_RS13420 WP_003152043.1 2599861..2600001(-) (degQ) [Bacillus velezensis strain 10075]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment