Detailed information NTG0262190

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: BLDA23_RS14160
• Genome accession: NZ_CP031126
• Coordinates: 2694497..2694934 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain 0DA23-1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2689497..2699934

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BLDA23_RS14110 (BLDA23_14110)	sinI	2689672..2689848 (+)	177	WP_003183444.1	anti-repressor SinI family protein	Regulator
BLDA23_RS14115 (BLDA23_14115)	sinR	2689882..2690217 (+)	336	WP_006637528.1	helix-turn-helix domain-containing protein	Regulator
BLDA23_RS14120 (BLDA23_14120)	-	2690322..2691116 (-)	795	WP_003183447.1	TasA family protein	-
BLDA23_RS14125 (BLDA23_14125)	-	2691190..2691774 (-)	585	WP_003183449.1	signal peptidase I	-
BLDA23_RS14130 (BLDA23_14130)	tapA	2691771..2692499 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
BLDA23_RS14135 (BLDA23_14135)	-	2692809..2693096 (+)	288	WP_223307118.1	YqzG/YhdC family protein	-
BLDA23_RS14140 (BLDA23_14140)	-	2693120..2693302 (-)	183	WP_003183456.1	YqzE family protein	-
BLDA23_RS14145 (BLDA23_14145)	comGG	2693391..2693756 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
BLDA23_RS14150 (BLDA23_14150)	comGF	2693769..2694257 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
BLDA23_RS14155 (BLDA23_14155)	comGE	2694166..2694513 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
BLDA23_RS14160 (BLDA23_14160)	comGD	2694497..2694934 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
BLDA23_RS14165 (BLDA23_14165)	comGC	2694940..2695233 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
BLDA23_RS14170 (BLDA23_14170)	comGB	2695247..2696281 (-)	1035	WP_080626943.1	competence type IV pilus assembly protein ComGB	Machinery gene
BLDA23_RS14175 (BLDA23_14175)	comGA	2696271..2697335 (-)	1065	WP_073425737.1	competence type IV pilus ATPase ComGA	Machinery gene
BLDA23_RS14180 (BLDA23_14180)	-	2697492..2698331 (-)	840	WP_080626944.1	STAS domain-containing protein	-
BLDA23_RS14190 (BLDA23_14190)	-	2698573..2698950 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
BLDA23_RS14195 (BLDA23_14195)	-	2699159..2699404 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=262190 BLDA23_RS14160 WP_009327905.1 2694497..2694934(-) (comGD) [Bacillus licheniformis strain 0DA23-1]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=262190 BLDA23_RS14160 WP_009327905.1 2694497..2694934(-) (comGD) [Bacillus licheniformis strain 0DA23-1]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393