Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | CXR48_RS14770 | Genome accession | NZ_CP025341 |
| Coordinates | 3022903..3023043 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain CMT-6 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3017903..3028043
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXR48_RS14745 | - | 3018243..3018626 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| CXR48_RS14750 | comA | 3018648..3019292 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| CXR48_RS14755 | comP | 3019373..3021664 (-) | 2292 | WP_101312053.1 | histidine kinase | Regulator |
| CXR48_RS14760 | comX | 3021676..3021840 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| CXR48_RS14765 | - | 3021840..3022751 (-) | 912 | WP_014305720.1 | polyprenyl synthetase family protein | - |
| CXR48_RS14770 | degQ | 3022903..3023043 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| CXR48_RS14775 | - | 3023509..3023850 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| CXR48_RS14780 | - | 3023857..3025077 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| CXR48_RS14785 | - | 3025207..3026673 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| CXR48_RS14790 | - | 3026691..3027242 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| CXR48_RS14795 | - | 3027339..3027737 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=260192 CXR48_RS14770 WP_003152043.1 3022903..3023043(-) (degQ) [Bacillus velezensis strain CMT-6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=260192 CXR48_RS14770 WP_003152043.1 3022903..3023043(-) (degQ) [Bacillus velezensis strain CMT-6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |