Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   CXR48_RS14770 Genome accession   NZ_CP025341
Coordinates   3022903..3023043 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CMT-6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3017903..3028043
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CXR48_RS14745 - 3018243..3018626 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  CXR48_RS14750 comA 3018648..3019292 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  CXR48_RS14755 comP 3019373..3021664 (-) 2292 WP_101312053.1 histidine kinase Regulator
  CXR48_RS14760 comX 3021676..3021840 (-) 165 WP_007613432.1 competence pheromone ComX -
  CXR48_RS14765 - 3021840..3022751 (-) 912 WP_014305720.1 polyprenyl synthetase family protein -
  CXR48_RS14770 degQ 3022903..3023043 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CXR48_RS14775 - 3023509..3023850 (+) 342 WP_014305721.1 hypothetical protein -
  CXR48_RS14780 - 3023857..3025077 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  CXR48_RS14785 - 3025207..3026673 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  CXR48_RS14790 - 3026691..3027242 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  CXR48_RS14795 - 3027339..3027737 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=260192 CXR48_RS14770 WP_003152043.1 3022903..3023043(-) (degQ) [Bacillus velezensis strain CMT-6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=260192 CXR48_RS14770 WP_003152043.1 3022903..3023043(-) (degQ) [Bacillus velezensis strain CMT-6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment