Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   CXR48_RS01950 Genome accession   NZ_CP025341
Coordinates   413777..413896 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain CMT-6     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 408777..418896
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CXR48_RS01935 - 410389..411072 (+) 684 WP_024084885.1 response regulator transcription factor -
  CXR48_RS01940 - 411059..412492 (+) 1434 WP_161625271.1 sensor histidine kinase -
  CXR48_RS01945 rapC 412645..413793 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  CXR48_RS01950 phrC 413777..413896 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  CXR48_RS01955 - 414046..414156 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  CXR48_RS01960 - 414236..415600 (-) 1365 WP_003156333.1 aspartate kinase -
  CXR48_RS01970 ceuB 416015..416968 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  CXR48_RS01975 - 416958..417905 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  CXR48_RS01980 - 417899..418657 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=260141 CXR48_RS01950 WP_003156334.1 413777..413896(+) (phrC) [Bacillus velezensis strain CMT-6]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=260141 CXR48_RS01950 WP_003156334.1 413777..413896(+) (phrC) [Bacillus velezensis strain CMT-6]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment