Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   DQ228_RS08290 Genome accession   NZ_CP030250
Coordinates   1610143..1610382 (-) Length   79 a.a.
NCBI ID   WP_011681565.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain CS20     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1605143..1615382
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQ228_RS08255 - 1606867..1607247 (-) 381 WP_002951783.1 hypothetical protein -
  DQ228_RS08260 - 1607372..1607635 (-) 264 WP_002945924.1 hypothetical protein -
  DQ228_RS08265 - 1607957..1608253 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  DQ228_RS08270 - 1608418..1608624 (-) 207 WP_011681562.1 hypothetical protein -
  DQ228_RS08275 - 1608655..1609347 (-) 693 WP_224103184.1 thioredoxin family protein -
  DQ228_RS08280 - 1609531..1609710 (-) 180 WP_011681564.1 hypothetical protein -
  DQ228_RS08285 - 1609739..1610131 (-) 393 WP_003094909.1 hypothetical protein -
  DQ228_RS08290 cipB 1610143..1610382 (-) 240 WP_011681565.1 Blp family class II bacteriocin Regulator
  DQ228_RS10190 - 1610633..1611034 (-) 402 WP_011226490.1 hypothetical protein -
  DQ228_RS08295 - 1612039..1612269 (-) 231 WP_011226494.1 bacteriocin class II family protein -
  DQ228_RS08300 - 1612626..1612826 (-) 201 WP_011681569.1 hypothetical protein -
  DQ228_RS08305 - 1612819..1613022 (-) 204 WP_232979828.1 Blp family class II bacteriocin -
  DQ228_RS08310 - 1613272..1614009 (+) 738 WP_024010062.1 LytR/AlgR family response regulator transcription factor -
  DQ228_RS08315 comD/blpH 1614540..1615343 (+) 804 WP_228024405.1 ATP-binding protein Regulator

Sequence

Protein


Download         Length: 79 a.a.        Molecular weight: 7727.69 Da        Isoelectric Point: 3.8735

>NTDB_id=259556 DQ228_RS08290 WP_011681565.1 1610143..1610382(-) (cipB) [Streptococcus thermophilus strain CS20]
MATQTIENFNTLDLETLASVEGGRVNWERWGMCGASVAVGASEGFSAAAGGTAFFIGPYAIGTGAVGAAIGGGVALLGC

Nucleotide


Download         Length: 240 bp        

>NTDB_id=259556 DQ228_RS08290 WP_011681565.1 1610143..1610382(-) (cipB) [Streptococcus thermophilus strain CS20]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAATGTGTGGGGCCTCTGTCGCCGTAGGTGCTTCAGAAGGATTCTCTGCAGCTGCAGGTGGAACGGCTT
TCTTCATTGGACCGTATGCAATTGGAACTGGTGCAGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(7-74)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.459

77.215

0.405

Multiple sequence alignment