Detailed information    

experimental Experimentally validated

Overview


Name   recO   Type   Machinery gene
Locus tag   BSU_25280 Genome accession   NC_000964
Coordinates   2608946..2609713 (-) Length   255 a.a.
NCBI ID   NP_390406.2    Uniprot ID   P42095
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   ssDNA annealing; plasmid transformation   
DNA processing Homologous recombination

Function


Establishment of circular plasmid DNA requires accumulation of RecO at the competence pole, most likely mediating single-strand annealing.


Genomic Context


Location: 2603946..2614713
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_25240 (BSU25240) ppsR 2604121..2604933 (-) 813 NP_390402.1 bifunctional ADP-dependent kinase-Pi-dependent pyrophosphorylase / positive regulator of gluconeogenesis -
  BSU_25250 (BSU25250) ccpN 2604959..2605597 (-) 639 NP_390403.1 negative regulator of gluconeogenesis -
  BSU_25260 (BSU25260) glyS 2605730..2607769 (-) 2040 NP_390404.2 glycyl-tRNA synthetase (beta subunit) -
  BSU_25270 (BSU25270) glyQ 2607762..2608649 (-) 888 NP_390405.1 glycyl-tRNA synthetase (alpha subunit) -
  BSU_25280 (BSU25280) recO 2608946..2609713 (-) 768 NP_390406.2 DNA double strand break repair and homologous recombination factor Machinery gene
  BSU_25289 (BSU25289) yqzL 2609750..2609893 (-) 144 YP_003097761.1 hypothetical protein -
  BSU_25290 (BSU25290) era 2610041..2610946 (-) 906 NP_390407.1 maturation of 16S RNA and assembly of 30S ribosomal subunit GTPase -
  BSU_25300 (BSU25300) cdd 2610927..2611337 (-) 411 NP_390408.1 cytidine/deoxycytidine deaminase -
  BSU_25310 (BSU25310) unpK 2611456..2611827 (-) 372 NP_390409.2 undecaprenol kinase -
  BSU_25320 (BSU25320) rnrY 2611808..2612281 (-) 474 NP_390410.2 endonuclease involved in 70S ribosomes quality control -
  BSU_25330 (BSU25330) pgpH 2612282..2614417 (-) 2136 NP_390411.1 c-di-AMP-degrading phosphodiesterases -

Sequence


Protein


Download         Length: 255 a.a.        Molecular weight: 29328.02 Da        Isoelectric Point: 8.3080

>NTDB_id=118 BSU_25280 NP_390406.2 2608946..2609713(-) (recO) [Bacillus subtilis subsp. subtilis str. 168]
MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPNSRLSAVSQPFLYGSFLMQKTSGLGTLQQGEMILSMRG
IREDLFLTAYAAYVAELVDRGTEEKKPNPYLFEFILESLKQLNEGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSQDG
TFHFSVRDNGFICHRCFEKDPYRIPIKPQTARLLRLFYYFDLSRLGNVSLKEETKAELKQVIDLYYEEYSGLYLKSKRFL
DQMESMKHLMGENKS

Nucleotide


Download         Length: 768 bp        

>NTDB_id=118 BSU_25280 NP_390406.2 2608946..2609713(-) (recO) [Bacillus subtilis subsp. subtilis str. 168]
ATGCTGACAAAATGTGAAGGGATCGTTCTTCGCACAAATGATTACGGAGAGACGAATAAAATCGTAACATTACTGACAAG
AGAACACGGAAAAATAGGTGTTATGGCACGAGGCGCCAAAAAACCGAACAGCCGTTTATCAGCAGTCAGCCAGCCCTTTT
TGTATGGTTCTTTCTTAATGCAAAAAACATCGGGCCTCGGAACGCTTCAGCAGGGGGAAATGATCCTCAGCATGAGAGGC
ATCAGGGAAGACTTGTTTTTAACAGCATATGCTGCCTATGTTGCTGAGTTAGTCGACAGAGGCACAGAAGAAAAAAAGCC
AAATCCTTATTTATTTGAATTCATATTAGAATCATTAAAACAGTTGAATGAAGGAACAGATCCGGATGTTATCACCTTCA
TTGTTCAAATGAAGATGCTCGGTGTCATGGGCCTGTATCCTGAGCTGAATCATTGTGTACATTGTAAAAGCCAAGACGGA
ACCTTTCATTTCTCTGTTCGTGATAATGGTTTTATATGCCACCGCTGTTTTGAAAAAGATCCTTACAGGATACCGATTAA
ACCGCAAACGGCAAGGCTGTTAAGGCTCTTTTACTATTTTGATCTGTCGAGACTCGGCAATGTGTCCTTAAAAGAGGAAA
CAAAAGCTGAATTAAAGCAAGTGATTGATTTATATTACGAAGAATATTCGGGATTGTATTTAAAATCAAAGCGCTTTTTA
GATCAAATGGAAAGCATGAAACATCTTATGGGTGAAAACAAAAGTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P42095

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Ester Serrano et al. (2018) RecA Regulation by RecU and DprA During Bacillus subtilis Natural Plasmid Transformation. Frontiers in Microbiology 9:1514. [PMID: 30050509]
[2] Begoña Carrasco et al. (2015) Bacillus subtilis RecO and SsbA are crucial for RecA-mediated recombinational DNA repair. Nucleic Acids Research 43(12):5984-97. [PMID: 26001966]
[3] Ignacija Vlašić et al. (2014) Bacillus subtilis RecA and its accessory factors, RecF, RecO, RecR and RecX, are required for spore resistance to DNA double-strand break. Nucleic Acids Research 42(4):2295-307. [PMID: 24285298]
[4] Justin S Lenhart et al. (2014) RecO and RecR are necessary for RecA loading in response to DNA damage and replication fork stress. Journal of Bacteriology 196(15):2851-60. [PMID: 24891441]
[5] Candela Manfredi et al. (2008) Bacillus subtilis RecO nucleates RecA onto SsbA-coated single-stranded DNA. The Journal of Biological Chemistry 283(36):24837-47. [PMID: 18599486]
[6] Dawit Kidane et al. (2004) Visualization of DNA double-strand break repair in live bacteria reveals dynamic recruitment of Bacillus subtilis RecF, RecO and RecN proteins to distinct sites on the nucleoids. Molecular Microbiology 52(6):1627-39. [PMID: 15186413]
[7] S Fernández et al. (1999) Analysis of the Bacillus subtilis recO gene: RecO forms part of the RecFLOR function. Molecular & General Genetics : MGG 261(3):567-73. [PMID: 10323239]