Detailed information
Bioinformatically predicted
Overview
| Name | HI0659 | Type | Machinery gene |
| Locus tag | CXP32_RS05695 | Genome accession | NZ_CP025256 |
| Coordinates | 1071640..1071933 (+) | Length | 97 a.a. |
| NCBI ID | WP_000794247.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain Xen35 | ||
| Function | DNA uptake (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1063231..1119540 | 1071640..1071933 | within | 0 |
Gene organization within MGE regions
Location: 1063231..1119540
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXP32_RS05630 (CXP32_05630) | - | 1063231..1064394 (-) | 1164 | WP_001021837.1 | site-specific integrase | - |
| CXP32_RS05635 (CXP32_05635) | - | 1064469..1065317 (-) | 849 | WP_000700645.1 | helix-turn-helix transcriptional regulator | - |
| CXP32_RS12725 (CXP32_05640) | - | 1065437..1065790 (+) | 354 | WP_000032304.1 | helix-turn-helix transcriptional regulator | - |
| CXP32_RS05645 (CXP32_05645) | - | 1065890..1066156 (+) | 267 | WP_000404762.1 | hypothetical protein | - |
| CXP32_RS12055 | - | 1066167..1066319 (+) | 153 | WP_000706985.1 | hypothetical protein | - |
| CXP32_RS05650 (CXP32_05650) | - | 1066524..1067141 (+) | 618 | WP_000424676.1 | Rha family transcriptional regulator | - |
| CXP32_RS05655 (CXP32_05655) | - | 1067176..1067628 (+) | 453 | WP_000141102.1 | hypothetical protein | - |
| CXP32_RS05660 (CXP32_05660) | - | 1067625..1068071 (+) | 447 | WP_000171242.1 | DnaD domain protein | - |
| CXP32_RS05665 (CXP32_05665) | - | 1068083..1068967 (+) | 885 | WP_000838905.1 | ATP-binding protein | - |
| CXP32_RS05670 (CXP32_05670) | - | 1069216..1069866 (+) | 651 | WP_000138311.1 | hypothetical protein | - |
| CXP32_RS05675 (CXP32_05675) | - | 1069913..1070341 (+) | 429 | WP_000918210.1 | hypothetical protein | - |
| CXP32_RS05680 (CXP32_05680) | - | 1070349..1070660 (+) | 312 | WP_001113833.1 | hypothetical protein | - |
| CXP32_RS05685 (CXP32_05685) | - | 1070678..1071088 (+) | 411 | WP_000162610.1 | hypothetical protein | - |
| CXP32_RS05690 (CXP32_05690) | - | 1071285..1071650 (+) | 366 | WP_000551587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| CXP32_RS05695 (CXP32_05695) | HI0659 | 1071640..1071933 (+) | 294 | WP_000794247.1 | helix-turn-helix transcriptional regulator | Machinery gene |
| CXP32_RS05700 (CXP32_05700) | - | 1071951..1073141 (+) | 1191 | WP_000123149.1 | hypothetical protein | - |
| CXP32_RS12060 | - | 1073144..1073320 (+) | 177 | WP_000346914.1 | hypothetical protein | - |
| CXP32_RS05705 (CXP32_05705) | - | 1073640..1074086 (-) | 447 | WP_061631657.1 | tyrosine-type recombinase/integrase | - |
| CXP32_RS05710 (CXP32_05710) | - | 1073986..1074831 (-) | 846 | Protein_1080 | IS630 family transposase | - |
| CXP32_RS05720 (CXP32_05720) | - | 1075002..1075157 (+) | 156 | Protein_1081 | diacylglycerol kinase family lipid kinase | - |
| CXP32_RS05725 (CXP32_05725) | rexB | 1075357..1078632 (+) | 3276 | WP_000772372.1 | ATP-dependent nuclease subunit B | - |
| CXP32_RS05730 (CXP32_05730) | addA | 1078629..1082279 (+) | 3651 | WP_000767212.1 | helicase-exonuclease AddAB subunit AddA | - |
| CXP32_RS05740 (CXP32_05740) | - | 1082494..1083672 (+) | 1179 | WP_000174755.1 | hypothetical protein | - |
| CXP32_RS05745 (CXP32_05745) | iga | 1083881..1089895 (+) | 6015 | WP_000417180.1 | immunoglobulin A1 protease | - |
| CXP32_RS05755 (CXP32_05755) | ylqF | 1090342..1091193 (+) | 852 | WP_000201315.1 | ribosome biogenesis GTPase YlqF | - |
| CXP32_RS05760 (CXP32_05760) | - | 1091180..1091959 (+) | 780 | WP_000201098.1 | ribonuclease HII | - |
| CXP32_RS05765 (CXP32_05765) | - | 1091975..1093525 (+) | 1551 | WP_000392544.1 | ClC family H(+)/Cl(-) exchange transporter | - |
| CXP32_RS05770 (CXP32_05770) | xerS | 1094109..1095179 (+) | 1071 | WP_000817881.1 | tyrosine recombinase XerS | - |
| CXP32_RS05775 (CXP32_05775) | - | 1095244..1096233 (-) | 990 | WP_000873990.1 | lipoate--protein ligase | - |
| CXP32_RS05780 (CXP32_05780) | lpdA | 1096297..1098000 (-) | 1704 | WP_001162908.1 | dihydrolipoyl dehydrogenase | - |
| CXP32_RS05785 (CXP32_05785) | - | 1098046..1099089 (-) | 1044 | WP_000752705.1 | dihydrolipoamide acetyltransferase | - |
| CXP32_RS05790 (CXP32_05790) | - | 1099307..1100299 (-) | 993 | WP_000448724.1 | alpha-ketoacid dehydrogenase subunit beta | - |
| CXP32_RS05795 (CXP32_05795) | - | 1100315..1101283 (-) | 969 | WP_000105360.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
| CXP32_RS05800 (CXP32_05800) | pdrM | 1101437..1102798 (-) | 1362 | WP_000278524.1 | sodium-coupled multidrug efflux MATE transporter PdrM | - |
| CXP32_RS05805 (CXP32_05805) | - | 1102809..1103069 (-) | 261 | WP_001105925.1 | hypothetical protein | - |
| CXP32_RS05810 (CXP32_05810) | - | 1103083..1104351 (-) | 1269 | WP_000924508.1 | dihydroorotase | - |
| CXP32_RS05815 (CXP32_05815) | - | 1104364..1104828 (-) | 465 | WP_001135768.1 | 8-oxo-dGTP diphosphatase | - |
| CXP32_RS05820 (CXP32_05820) | - | 1104838..1105491 (-) | 654 | WP_000401326.1 | uracil-DNA glycosylase | - |
| CXP32_RS05825 (CXP32_05825) | - | 1105629..1106231 (-) | 603 | WP_001812270.1 | hypothetical protein | - |
| CXP32_RS05830 (CXP32_05830) | - | 1106289..1107002 (-) | 714 | WP_000499429.1 | YjjG family noncanonical pyrimidine nucleotidase | - |
| CXP32_RS05835 (CXP32_05835) | dhaM | 1107462..1107836 (-) | 375 | WP_000443795.1 | dihydroxyacetone kinase phosphoryl donor subunit DhaM | - |
| CXP32_RS12730 | - | 1107836..1107910 (-) | 75 | Protein_1103 | dihydroxyacetone kinase subunit L | - |
| CXP32_RS05840 (CXP32_05840) | phtB | 1108258..1110717 (-) | 2460 | WP_000700388.1 | pneumococcal histidine triad protein PhtB | - |
| CXP32_RS05845 (CXP32_05845) | phtA | 1110875..1113325 (-) | 2451 | WP_000700482.1 | pneumococcal histidine triad protein PhtA | - |
| CXP32_RS05850 (CXP32_05850) | ptsP | 1113579..1115312 (-) | 1734 | WP_000138135.1 | phosphoenolpyruvate--protein phosphotransferase | - |
| CXP32_RS05855 (CXP32_05855) | - | 1115318..1115581 (-) | 264 | WP_000146947.1 | phosphocarrier protein HPr | - |
| CXP32_RS05860 (CXP32_05860) | nrdH | 1115932..1116150 (+) | 219 | WP_000259249.1 | glutaredoxin-like protein NrdH | - |
| CXP32_RS05865 (CXP32_05865) | nrdE | 1116231..1118390 (+) | 2160 | WP_000523249.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| CXP32_RS05870 (CXP32_05870) | nrdF | 1118578..1119540 (+) | 963 | WP_000451370.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
Sequence
Protein
Download Length: 97 a.a. Molecular weight: 10751.45 Da Isoelectric Point: 5.1991
>NTDB_id=259459 CXP32_RS05695 WP_000794247.1 1071640..1071933(+) (HI0659) [Streptococcus pneumoniae strain Xen35]
MKNNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEHEQV
MKNNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEHEQV
Nucleotide
Download Length: 294 bp
>NTDB_id=259459 CXP32_RS05695 WP_000794247.1 1071640..1071933(+) (HI0659) [Streptococcus pneumoniae strain Xen35]
ATGAAAAATAATGCTATTGGTAGTAACTGGAAAGATGTAAGAGCTGAATTATTCAGCAAAGAGGAAATTTTGGAAAGTGA
TATGCGCGTGGCTATCATGAGTGAGCTTATCGAGGCTAGAAATGAAAAGGGTATTAGTCAGAAGAAACTAGAGGAGATGA
GCGGTGTTAGTCAGCCAGTTATCGCTAGAATGGAAACAGGAAAGACAAGCCCACAACTTGATACAGTATTAAAAGTGTTG
GCAAGTCTTGGTAAGACCTTAGCTGTTGTACCATTAGAGCATGAGCAGGTTTAG
ATGAAAAATAATGCTATTGGTAGTAACTGGAAAGATGTAAGAGCTGAATTATTCAGCAAAGAGGAAATTTTGGAAAGTGA
TATGCGCGTGGCTATCATGAGTGAGCTTATCGAGGCTAGAAATGAAAAGGGTATTAGTCAGAAGAAACTAGAGGAGATGA
GCGGTGTTAGTCAGCCAGTTATCGCTAGAATGGAAACAGGAAAGACAAGCCCACAACTTGATACAGTATTAAAAGTGTTG
GCAAGTCTTGGTAAGACCTTAGCTGTTGTACCATTAGAGCATGAGCAGGTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| HI0659 | Haemophilus influenzae Rd KW20 |
57.143 |
93.814 |
0.536 |