Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | DOU34_RS13775 | Genome accession | NZ_CP030097 |
| Coordinates | 2796777..2796917 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain SH-B74 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2791777..2801917
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DOU34_RS13750 | - | 2792117..2792500 (-) | 384 | WP_061047114.1 | hotdog fold thioesterase | - |
| DOU34_RS13755 | comA | 2792522..2793166 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| DOU34_RS13760 | comP | 2793247..2795538 (-) | 2292 | WP_042635452.1 | histidine kinase | Regulator |
| DOU34_RS13765 | comX | 2795550..2795714 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| DOU34_RS13770 | comQ | 2795714..2796625 (-) | 912 | WP_079891433.1 | polyprenyl synthetase family protein | Regulator |
| DOU34_RS13775 | degQ | 2796777..2796917 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| DOU34_RS13785 | - | 2797380..2797721 (+) | 342 | WP_007408677.1 | hypothetical protein | - |
| DOU34_RS13790 | - | 2797728..2798951 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| DOU34_RS13795 | - | 2799081..2800547 (-) | 1467 | WP_020954301.1 | nicotinate phosphoribosyltransferase | - |
| DOU34_RS13800 | - | 2800565..2801116 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| DOU34_RS13805 | - | 2801213..2801611 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=258595 DOU34_RS13775 WP_003152043.1 2796777..2796917(-) (degQ) [Bacillus amyloliquefaciens strain SH-B74]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=258595 DOU34_RS13775 WP_003152043.1 2796777..2796917(-) (degQ) [Bacillus amyloliquefaciens strain SH-B74]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |