Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   DOU34_RS00580 Genome accession   NZ_CP030097
Coordinates   140677..140796 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain SH-B74     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 135677..145796
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DOU34_RS00565 - 137289..137972 (+) 684 WP_007410267.1 response regulator transcription factor -
  DOU34_RS00570 - 137959..139392 (+) 1434 WP_020955322.1 ATP-binding protein -
  DOU34_RS00575 rapC 139545..140693 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  DOU34_RS00580 phrC 140677..140796 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  DOU34_RS00585 - 140944..141039 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  DOU34_RS00590 - 141134..142498 (-) 1365 WP_015239155.1 aspartate kinase -
  DOU34_RS00595 ceuB 142912..143865 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  DOU34_RS00600 - 143855..144802 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  DOU34_RS00605 - 144796..145554 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=258497 DOU34_RS00580 WP_003156334.1 140677..140796(+) (phrC) [Bacillus amyloliquefaciens strain SH-B74]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=258497 DOU34_RS00580 WP_003156334.1 140677..140796(+) (phrC) [Bacillus amyloliquefaciens strain SH-B74]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718