Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   BVQ_RS13050 Genome accession   NZ_CP025079
Coordinates   2631403..2631669 (-) Length   88 a.a.
NCBI ID   WP_053573229.1    Uniprot ID   -
Organism   Bacillus velezensis strain QST713     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2626403..2636669
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVQ_RS13000 (BVQ_12990) sinR 2626567..2626902 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BVQ_RS13005 (BVQ_12995) tasA 2626950..2627735 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BVQ_RS13010 (BVQ_13000) sipW 2627800..2628384 (-) 585 WP_015240205.1 signal peptidase I SipW -
  BVQ_RS13015 (BVQ_13005) tapA 2628356..2629027 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  BVQ_RS13020 (BVQ_13010) - 2629286..2629615 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  BVQ_RS13025 (BVQ_13015) - 2629655..2629834 (-) 180 WP_003153093.1 YqzE family protein -
  BVQ_RS13030 (BVQ_13020) comGG 2629891..2630268 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BVQ_RS13035 (BVQ_13025) comGF 2630269..2630769 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  BVQ_RS13040 (BVQ_13030) comGE 2630678..2630992 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  BVQ_RS13045 (BVQ_13035) comGD 2630976..2631413 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  BVQ_RS13050 (BVQ_13040) comGC 2631403..2631669 (-) 267 WP_053573229.1 competence type IV pilus major pilin ComGC Machinery gene
  BVQ_RS13055 (BVQ_13045) comGB 2631716..2632753 (-) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  BVQ_RS13060 (BVQ_13050) comGA 2632740..2633810 (-) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  BVQ_RS13065 (BVQ_13055) - 2634003..2634953 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  BVQ_RS13070 (BVQ_13060) - 2635099..2636400 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9748.43 Da        Isoelectric Point: 6.2027

>NTDB_id=258210 BVQ_RS13050 WP_053573229.1 2631403..2631669(-) (comGC) [Bacillus velezensis strain QST713]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQIMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTVCPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=258210 BVQ_RS13050 WP_053573229.1 2631403..2631669(-) (comGC) [Bacillus velezensis strain QST713]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGATTATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGTCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment