Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | CWI64_RS09700 | Genome accession | NZ_CP025076 |
| Coordinates | 1801217..1801366 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain BHN97x | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1796217..1806366
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CWI64_RS09670 (CWI64_09670) | blpC | 1796511..1796666 (-) | 156 | WP_000358817.1 | quorum-sensing system pheromone BlpC | - |
| CWI64_RS09675 (CWI64_09675) | - | 1796723..1798084 (-) | 1362 | WP_001069082.1 | bacteriocin secretion accessory protein | - |
| CWI64_RS09680 (CWI64_09680) | blpA | 1798095..1800220 (-) | 2126 | Protein_1777 | peptide cleavage/export ABC transporter BlpA | - |
| CWI64_RS09685 (CWI64_09685) | blpM | 1800500..1800754 (+) | 255 | WP_001093257.1 | two-peptide bacteriocin subunit BlpM | - |
| CWI64_RS09690 (CWI64_09690) | blpN | 1800770..1800973 (+) | 204 | WP_001099490.1 | two-peptide bacteriocin subunit BlpN | - |
| CWI64_RS09700 (CWI64_09700) | cipB | 1801217..1801366 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| CWI64_RS09705 (CWI64_09705) | - | 1801470..1801589 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| CWI64_RS09710 (CWI64_09710) | - | 1801887..1802048 (+) | 162 | WP_000727120.1 | hypothetical protein | - |
| CWI64_RS09715 (CWI64_09715) | - | 1802110..1802429 (+) | 320 | Protein_1783 | immunity protein | - |
| CWI64_RS09725 (CWI64_09725) | - | 1803058..1803441 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| CWI64_RS09730 (CWI64_09730) | - | 1803493..1804182 (+) | 690 | WP_000760525.1 | CPBP family intramembrane glutamic endopeptidase | - |
| CWI64_RS09735 (CWI64_09735) | blpZ | 1804224..1804472 (+) | 249 | WP_000276502.1 | immunity protein BlpZ | - |
| CWI64_RS09740 (CWI64_09740) | - | 1804502..1805113 (+) | 612 | WP_000394027.1 | type II CAAX endopeptidase family protein | - |
| CWI64_RS09745 (CWI64_09745) | - | 1805275..1806069 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=258122 CWI64_RS09700 WP_001809846.1 1801217..1801366(+) (cipB) [Streptococcus pneumoniae strain BHN97x]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=258122 CWI64_RS09700 WP_001809846.1 1801217..1801366(+) (cipB) [Streptococcus pneumoniae strain BHN97x]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |