Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   CVD07_RS01790 Genome accession   NZ_CP024897
Coordinates   361544..361663 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain CN026     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 356544..366663
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CVD07_RS01775 (CVD07_01775) - 358156..358839 (+) 684 WP_014416901.1 response regulator transcription factor -
  CVD07_RS01780 (CVD07_01780) - 358826..360253 (+) 1428 WP_100261600.1 HAMP domain-containing sensor histidine kinase -
  CVD07_RS01785 (CVD07_01785) rapC 360412..361560 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  CVD07_RS01790 (CVD07_01790) phrC 361544..361663 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  CVD07_RS01795 (CVD07_01795) - 361815..361910 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  CVD07_RS01800 (CVD07_01800) - 362005..363369 (-) 1365 WP_045508518.1 aspartate kinase -
  CVD07_RS01805 (CVD07_01805) ceuB 363783..364736 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  CVD07_RS01810 (CVD07_01810) - 364726..365673 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  CVD07_RS01815 (CVD07_01815) - 365667..366425 (+) 759 WP_063636991.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=256220 CVD07_RS01790 WP_003156334.1 361544..361663(+) (phrC) [Bacillus velezensis strain CN026]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=256220 CVD07_RS01790 WP_003156334.1 361544..361663(+) (phrC) [Bacillus velezensis strain CN026]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment