Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CUB85_RS12640 Genome accession   NZ_CP024797
Coordinates   2571276..2571449 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain TJ02     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2566276..2576449
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CUB85_RS12625 gcvT 2567089..2568189 (-) 1101 WP_100001554.1 glycine cleavage system aminomethyltransferase GcvT -
  CUB85_RS12630 - 2568613..2570283 (+) 1671 WP_007408331.1 DEAD/DEAH box helicase -
  CUB85_RS12635 - 2570305..2571099 (+) 795 WP_007408330.1 YqhG family protein -
  CUB85_RS12640 sinI 2571276..2571449 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CUB85_RS12645 sinR 2571483..2571818 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CUB85_RS12650 tasA 2571866..2572651 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CUB85_RS12655 sipW 2572716..2573300 (-) 585 WP_007408328.1 signal peptidase I SipW -
  CUB85_RS12660 tapA 2573272..2573943 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  CUB85_RS12665 - 2574202..2574531 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  CUB85_RS12670 - 2574571..2574750 (-) 180 WP_003153093.1 YqzE family protein -
  CUB85_RS12675 comGG 2574807..2575184 (-) 378 WP_039063315.1 competence type IV pilus minor pilin ComGG -
  CUB85_RS12680 comGF 2575185..2575685 (-) 501 WP_258038902.1 competence type IV pilus minor pilin ComGF -
  CUB85_RS12685 comGE 2575594..2575908 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  CUB85_RS12690 comGD 2575892..2576329 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=255502 CUB85_RS12640 WP_003153105.1 2571276..2571449(+) (sinI) [Bacillus velezensis strain TJ02]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=255502 CUB85_RS12640 WP_003153105.1 2571276..2571449(+) (sinI) [Bacillus velezensis strain TJ02]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment