Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   CUC43_RS11005 Genome accession   NZ_CP024771
Coordinates   2012271..2012549 (+) Length   92 a.a.
NCBI ID   WP_029437228.1    Uniprot ID   -
Organism   Bacillus thuringiensis LM1212     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2004038..2042884 2012271..2012549 within 0


Gene organization within MGE regions


Location: 2004038..2042884
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CUC43_RS10950 (CUC43_11290) - 2004038..2005162 (-) 1125 WP_029437219.1 tyrosine-type recombinase/integrase -
  CUC43_RS10960 (CUC43_11300) - 2005438..2005782 (-) 345 WP_029437220.1 helix-turn-helix transcriptional regulator -
  CUC43_RS10965 (CUC43_11305) - 2006273..2007424 (+) 1152 WP_118991685.1 AimR family lysis-lysogeny pheromone receptor -
  CUC43_RS33640 - 2007460..2007615 (+) 156 WP_162901148.1 hypothetical protein -
  CUC43_RS33645 - 2007764..2007901 (+) 138 WP_162901149.1 hypothetical protein -
  CUC43_RS10970 (CUC43_11310) - 2007931..2008290 (-) 360 WP_029437221.1 helix-turn-helix transcriptional regulator -
  CUC43_RS10975 (CUC43_11315) - 2008461..2008664 (+) 204 WP_033694430.1 helix-turn-helix transcriptional regulator -
  CUC43_RS10980 (CUC43_11320) - 2008731..2009462 (+) 732 WP_029437223.1 ORF6C domain-containing protein -
  CUC43_RS10985 (CUC43_11325) - 2009506..2009856 (+) 351 WP_029437224.1 helix-turn-helix domain-containing protein -
  CUC43_RS33650 (CUC43_11330) - 2009853..2010020 (+) 168 WP_158001545.1 hypothetical protein -
  CUC43_RS33655 (CUC43_11335) - 2010050..2010226 (+) 177 WP_033694431.1 hypothetical protein -
  CUC43_RS10990 (CUC43_11340) - 2010231..2011118 (+) 888 WP_029437225.1 conserved phage C-terminal domain-containing protein -
  CUC43_RS10995 (CUC43_11345) - 2011133..2012047 (+) 915 WP_029437226.1 AAA family ATPase -
  CUC43_RS11000 (CUC43_11350) - 2012060..2012254 (+) 195 WP_029437227.1 hypothetical protein -
  CUC43_RS11005 (CUC43_11355) abrB 2012271..2012549 (+) 279 WP_029437228.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  CUC43_RS11010 (CUC43_11360) - 2012542..2012901 (+) 360 WP_001125952.1 hypothetical protein -
  CUC43_RS11015 (CUC43_11365) - 2012920..2013087 (+) 168 WP_000717826.1 DUF3954 domain-containing protein -
  CUC43_RS11020 (CUC43_11370) - 2013113..2013364 (+) 252 WP_029437229.1 hypothetical protein -
  CUC43_RS11025 (CUC43_11375) - 2013384..2013866 (+) 483 WP_029437230.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  CUC43_RS11030 (CUC43_11380) - 2013905..2014144 (+) 240 WP_029437231.1 hypothetical protein -
  CUC43_RS33660 - 2014158..2014331 (+) 174 WP_158001546.1 hypothetical protein -
  CUC43_RS11035 (CUC43_11385) - 2014365..2014697 (+) 333 WP_029437232.1 hypothetical protein -
  CUC43_RS11040 (CUC43_11390) - 2014725..2015420 (+) 696 WP_029437233.1 hypothetical protein -
  CUC43_RS11045 (CUC43_11395) - 2015638..2015817 (+) 180 WP_029437234.1 hypothetical protein -
  CUC43_RS11050 (CUC43_11400) - 2015856..2016038 (+) 183 WP_029437235.1 hypothetical protein -
  CUC43_RS11055 (CUC43_11405) - 2016075..2016311 (+) 237 WP_029437236.1 hypothetical protein -
  CUC43_RS11060 (CUC43_11410) - 2016571..2016753 (+) 183 WP_029437237.1 hypothetical protein -
  CUC43_RS11065 (CUC43_11415) - 2016734..2016964 (+) 231 WP_240441741.1 hypothetical protein -
  CUC43_RS11070 (CUC43_11420) - 2016975..2017097 (+) 123 WP_033694432.1 DUF3983 domain-containing protein -
  CUC43_RS11075 (CUC43_11425) - 2017118..2017300 (+) 183 WP_029437238.1 hypothetical protein -
  CUC43_RS33665 (CUC43_11430) - 2017405..2017575 (+) 171 WP_000866511.1 hypothetical protein -
  CUC43_RS11080 (CUC43_11435) - 2017596..2018072 (+) 477 WP_029437239.1 ArpU family phage packaging/lysis transcriptional regulator -
  CUC43_RS11085 (CUC43_11440) - 2018069..2018611 (+) 543 WP_029437240.1 site-specific integrase -
  CUC43_RS11090 (CUC43_11445) - 2019215..2019427 (+) 213 WP_029437241.1 DNA translocase FtsK -
  CUC43_RS34220 - 2019470..2019862 (+) 393 WP_029437242.1 hypothetical protein -
  CUC43_RS11100 (CUC43_11455) - 2019876..2020193 (+) 318 WP_029437243.1 hypothetical protein -
  CUC43_RS11105 (CUC43_11460) - 2020195..2020536 (+) 342 WP_029437244.1 hypothetical protein -
  CUC43_RS11110 (CUC43_11465) - 2020547..2020858 (+) 312 WP_029437245.1 HNH endonuclease signature motif containing protein -
  CUC43_RS11115 (CUC43_11470) - 2020862..2021161 (+) 300 WP_029437246.1 hypothetical protein -
  CUC43_RS11120 (CUC43_11475) - 2021268..2021591 (+) 324 WP_029437247.1 P27 family phage terminase small subunit -
  CUC43_RS11125 (CUC43_11480) - 2021572..2023245 (+) 1674 WP_029437248.1 terminase TerL endonuclease subunit -
  CUC43_RS11130 (CUC43_11485) - 2023262..2024425 (+) 1164 WP_029437249.1 phage portal protein -
  CUC43_RS11135 (CUC43_11490) - 2024522..2025640 (+) 1119 WP_029437250.1 IS110 family transposase -
  CUC43_RS11140 (CUC43_11495) - 2025991..2026734 (+) 744 WP_033694433.1 head maturation protease, ClpP-related -
  CUC43_RS11145 (CUC43_11500) - 2026772..2027914 (+) 1143 WP_029437251.1 phage major capsid protein -
  CUC43_RS11150 (CUC43_11505) - 2028076..2028381 (+) 306 WP_000438401.1 head-tail connector protein -
  CUC43_RS11155 (CUC43_11510) - 2028365..2028712 (+) 348 WP_029437252.1 hypothetical protein -
  CUC43_RS11160 (CUC43_11515) - 2028702..2029088 (+) 387 WP_029437253.1 hypothetical protein -
  CUC43_RS11165 (CUC43_11520) - 2029078..2029500 (+) 423 WP_029437254.1 hypothetical protein -
  CUC43_RS11170 (CUC43_11525) - 2029507..2030100 (+) 594 WP_029437255.1 hypothetical protein -
  CUC43_RS11175 (CUC43_11530) - 2030119..2030571 (+) 453 WP_029437256.1 hypothetical protein -
  CUC43_RS11180 (CUC43_11535) - 2030754..2032364 (+) 1611 WP_029437257.1 hypothetical protein -
  CUC43_RS34225 - 2032630..2034999 (+) 2370 WP_240441742.1 hypothetical protein -
  CUC43_RS11190 (CUC43_11545) - 2034992..2035678 (+) 687 WP_029437261.1 phage tail domain-containing protein -
  CUC43_RS11195 (CUC43_11550) - 2035675..2038290 (+) 2616 WP_029437262.1 phage tail spike protein -
  CUC43_RS11200 (CUC43_11555) - 2038280..2040004 (+) 1725 WP_118991686.1 BppU family phage baseplate upper protein -
  CUC43_RS11205 (CUC43_11560) - 2040092..2040514 (+) 423 WP_029437264.1 phage holin family protein -
  CUC43_RS11210 (CUC43_11565) - 2040597..2041790 (-) 1194 WP_029437265.1 IS110 family transposase -
  CUC43_RS11220 (CUC43_11575) - 2042087..2042884 (+) 798 WP_029437266.1 GH25 family lysozyme -

Sequence


Protein


Download         Length: 92 a.a.        Molecular weight: 10210.78 Da        Isoelectric Point: 5.7427

>NTDB_id=255366 CUC43_RS11005 WP_029437228.1 2012271..2012549(+) (abrB) [Bacillus thuringiensis LM1212]
MKNTGVSRKVDELGRVVIPIELRRNLGINEGTALGFHVEGENIVLRKQEKSCFVTGEVSESNMELLDGRMFLSKEGATEL
LDILEKSVKVHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=255366 CUC43_RS11005 WP_029437228.1 2012271..2012549(+) (abrB) [Bacillus thuringiensis LM1212]
ATGAAAAATACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATCCCAATAGAGTTACGCAGGAATTTGGG
GATTAATGAAGGGACGGCACTAGGCTTTCATGTTGAGGGTGAAAACATTGTTTTAAGAAAACAAGAAAAGTCATGCTTTG
TAACAGGTGAAGTTTCTGAATCAAACATGGAATTGCTAGACGGACGAATGTTTTTGAGCAAGGAAGGGGCAACTGAATTG
CTGGACATTCTTGAAAAGAGTGTGAAGGTACATGCCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

57.831

90.217

0.522


Multiple sequence alignment