Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   DL538_RS17070 Genome accession   NZ_CP029609
Coordinates   3242274..3242414 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain G7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3237274..3247414
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DL538_RS17045 (DL538_16950) yuxO 3237616..3237996 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  DL538_RS17050 (DL538_16955) comA 3238015..3238659 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  DL538_RS17055 (DL538_16960) comP 3238740..3241040 (-) 2301 WP_088300729.1 histidine kinase Regulator
  DL538_RS17060 (DL538_16965) comX 3241052..3241216 (-) 165 WP_015384519.1 competence pheromone ComX -
  DL538_RS17065 (DL538_16970) comQ 3241229..3242089 (-) 861 WP_041850585.1 polyprenyl synthetase family protein Regulator
  DL538_RS17070 (DL538_16975) degQ 3242274..3242414 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  DL538_RS17075 - 3242636..3242761 (+) 126 WP_003228793.1 hypothetical protein -
  DL538_RS17080 (DL538_16980) - 3242875..3243243 (+) 369 WP_014477834.1 hypothetical protein -
  DL538_RS17085 (DL538_16985) pdeH 3243219..3244448 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  DL538_RS17090 (DL538_16990) pncB 3244585..3246057 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  DL538_RS17095 (DL538_16995) pncA 3246073..3246624 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  DL538_RS17100 (DL538_17000) yueI 3246721..3247119 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=254983 DL538_RS17070 WP_003220708.1 3242274..3242414(-) (degQ) [Bacillus subtilis subsp. subtilis strain G7]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=254983 DL538_RS17070 WP_003220708.1 3242274..3242414(-) (degQ) [Bacillus subtilis subsp. subtilis strain G7]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1