Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   DL538_RS12740 Genome accession   NZ_CP029609
Coordinates   2481663..2481836 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis strain G7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2476663..2486836
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DL538_RS12725 (DL538_12680) gcvT 2477462..2478550 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  DL538_RS12730 (DL538_12685) hepAA 2478992..2480665 (+) 1674 WP_003230203.1 SNF2-related protein -
  DL538_RS12735 (DL538_12690) yqhG 2480686..2481480 (+) 795 WP_003230200.1 YqhG family protein -
  DL538_RS12740 (DL538_12695) sinI 2481663..2481836 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  DL538_RS12745 (DL538_12700) sinR 2481870..2482205 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DL538_RS12750 (DL538_12705) tasA 2482298..2483083 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  DL538_RS12755 (DL538_12710) sipW 2483148..2483720 (-) 573 WP_072692741.1 signal peptidase I SipW -
  DL538_RS12760 (DL538_12715) tapA 2483704..2484465 (-) 762 WP_131227614.1 amyloid fiber anchoring/assembly protein TapA -
  DL538_RS12765 (DL538_12720) yqzG 2484737..2485063 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  DL538_RS12770 (DL538_12725) spoIITA 2485105..2485284 (-) 180 WP_072175549.1 YqzE family protein -
  DL538_RS12775 (DL538_12730) comGG 2485355..2485729 (-) 375 WP_029317914.1 ComG operon protein ComGG Machinery gene
  DL538_RS12780 (DL538_12735) comGF 2485730..2486113 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  DL538_RS12785 (DL538_12740) comGE 2486139..2486486 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=254948 DL538_RS12740 WP_003230187.1 2481663..2481836(+) (sinI) [Bacillus subtilis subsp. subtilis strain G7]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=254948 DL538_RS12740 WP_003230187.1 2481663..2481836(+) (sinI) [Bacillus subtilis subsp. subtilis strain G7]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1