Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | DL538_RS12740 | Genome accession | NZ_CP029609 |
| Coordinates | 2481663..2481836 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis strain G7 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2476663..2486836
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DL538_RS12725 (DL538_12680) | gcvT | 2477462..2478550 (-) | 1089 | WP_015714248.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| DL538_RS12730 (DL538_12685) | hepAA | 2478992..2480665 (+) | 1674 | WP_003230203.1 | SNF2-related protein | - |
| DL538_RS12735 (DL538_12690) | yqhG | 2480686..2481480 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| DL538_RS12740 (DL538_12695) | sinI | 2481663..2481836 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| DL538_RS12745 (DL538_12700) | sinR | 2481870..2482205 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| DL538_RS12750 (DL538_12705) | tasA | 2482298..2483083 (-) | 786 | WP_014664586.1 | biofilm matrix protein TasA | - |
| DL538_RS12755 (DL538_12710) | sipW | 2483148..2483720 (-) | 573 | WP_072692741.1 | signal peptidase I SipW | - |
| DL538_RS12760 (DL538_12715) | tapA | 2483704..2484465 (-) | 762 | WP_131227614.1 | amyloid fiber anchoring/assembly protein TapA | - |
| DL538_RS12765 (DL538_12720) | yqzG | 2484737..2485063 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| DL538_RS12770 (DL538_12725) | spoIITA | 2485105..2485284 (-) | 180 | WP_072175549.1 | YqzE family protein | - |
| DL538_RS12775 (DL538_12730) | comGG | 2485355..2485729 (-) | 375 | WP_029317914.1 | ComG operon protein ComGG | Machinery gene |
| DL538_RS12780 (DL538_12735) | comGF | 2485730..2486113 (-) | 384 | WP_029317913.1 | ComG operon protein ComGF | Machinery gene |
| DL538_RS12785 (DL538_12740) | comGE | 2486139..2486486 (-) | 348 | WP_015714254.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=254948 DL538_RS12740 WP_003230187.1 2481663..2481836(+) (sinI) [Bacillus subtilis subsp. subtilis strain G7]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=254948 DL538_RS12740 WP_003230187.1 2481663..2481836(+) (sinI) [Bacillus subtilis subsp. subtilis strain G7]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |