Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CS547_RS15125 Genome accession   NZ_CP024647
Coordinates   3051074..3051214 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Lzh-5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3046074..3056214
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS547_RS15100 (CS547_15085) - 3046412..3046795 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  CS547_RS15105 (CS547_15090) comA 3046817..3047461 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  CS547_RS15110 (CS547_15095) - 3047542..3049835 (-) 2294 Protein_2885 histidine kinase -
  CS547_RS15115 (CS547_15100) comX 3049847..3050011 (-) 165 WP_007613432.1 competence pheromone ComX -
  CS547_RS15120 (CS547_15105) - 3050011..3050922 (-) 912 WP_022553710.1 polyprenyl synthetase family protein -
  CS547_RS15125 (CS547_15110) degQ 3051074..3051214 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CS547_RS15135 (CS547_15120) - 3051680..3052021 (+) 342 WP_014418765.1 hypothetical protein -
  CS547_RS15140 (CS547_15125) - 3052028..3053251 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  CS547_RS15145 (CS547_15130) - 3053381..3054847 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  CS547_RS15150 (CS547_15135) - 3054865..3055416 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  CS547_RS15155 (CS547_15140) - 3055513..3055911 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=254761 CS547_RS15125 WP_003152043.1 3051074..3051214(-) (degQ) [Bacillus velezensis strain Lzh-5]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=254761 CS547_RS15125 WP_003152043.1 3051074..3051214(-) (degQ) [Bacillus velezensis strain Lzh-5]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment