Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   DLJ51_RS08945 Genome accession   NZ_CP029560
Coordinates   1838067..1838252 (-) Length   61 a.a.
NCBI ID   WP_019771033.1    Uniprot ID   A0ABM6W745
Organism   Streptococcus sobrinus strain NIDR 6715-7     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1833067..1843252
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DLJ51_RS08910 (DLJ51_08910) - 1833749..1834438 (+) 690 WP_019775873.1 DUF1129 domain-containing protein -
  DLJ51_RS08920 (DLJ51_08920) rpsR 1834867..1835106 (-) 240 WP_002961569.1 30S ribosomal protein S18 -
  DLJ51_RS08925 (DLJ51_08925) ssb 1835164..1835646 (-) 483 WP_002961571.1 single-stranded DNA-binding protein Machinery gene
  DLJ51_RS08930 (DLJ51_08930) rpsF 1835658..1835948 (-) 291 WP_002961573.1 30S ribosomal protein S6 -
  DLJ51_RS08935 (DLJ51_08935) - 1836402..1837072 (-) 671 Protein_1683 TMEM175 family protein -
  DLJ51_RS10495 - 1837235..1837411 (-) 177 WP_019777830.1 hypothetical protein -
  DLJ51_RS08940 (DLJ51_08940) - 1837871..1838047 (-) 177 WP_019769837.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  DLJ51_RS08945 (DLJ51_08945) cipB 1838067..1838252 (-) 186 WP_019771033.1 hypothetical protein Regulator
  DLJ51_RS08950 (DLJ51_08950) - 1838334..1838507 (-) 174 WP_019790623.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  DLJ51_RS08955 (DLJ51_08955) cipB 1838529..1838714 (-) 186 WP_019769836.1 hypothetical protein Regulator
  DLJ51_RS08960 (DLJ51_08960) - 1839008..1839199 (-) 192 WP_019771035.1 bacteriocin -
  DLJ51_RS08965 (DLJ51_08965) - 1839502..1839725 (-) 224 Protein_1690 garvicin Q family class II bacteriocin -
  DLJ51_RS08970 (DLJ51_08970) - 1839946..1840935 (-) 990 WP_109982750.1 IS30 family transposase -
  DLJ51_RS08975 (DLJ51_08975) comB/nlmE 1841097..1842020 (-) 924 WP_109982751.1 HlyD family efflux transporter periplasmic adaptor subunit Regulator

Sequence

Protein


Download         Length: 61 a.a.        Molecular weight: 6600.32 Da        Isoelectric Point: 4.1024

>NTDB_id=254232 DLJ51_RS08945 WP_019771033.1 1838067..1838252(-) (cipB) [Streptococcus sobrinus strain NIDR 6715-7]
MNTIAFEKFETVDANSLMAIEGGWFWDNWKGGEWALAGAWALGPGTGIIATGFYNGYNSHG

Nucleotide


Download         Length: 186 bp        

>NTDB_id=254232 DLJ51_RS08945 WP_019771033.1 1838067..1838252(-) (cipB) [Streptococcus sobrinus strain NIDR 6715-7]
ATGAATACAATTGCATTTGAAAAATTTGAAACTGTTGACGCAAATAGTTTGATGGCCATTGAAGGTGGCTGGTTCTGGGA
TAACTGGAAAGGTGGCGAATGGGCGCTAGCTGGTGCATGGGCACTTGGCCCTGGTACAGGTATCATTGCCACAGGATTCT
ACAACGGATACAATTCACACGGATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

45.098

83.607

0.377

Multiple sequence alignment