Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   DK181_RS09220 Genome accession   NZ_CP029490
Coordinates   1884833..1885018 (-) Length   61 a.a.
NCBI ID   WP_019771033.1    Uniprot ID   A0ABM6W745
Organism   Streptococcus sobrinus strain SL1     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1879833..1890018
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DK181_RS09190 (DK182_09190) - 1880511..1881200 (+) 690 WP_002961565.1 DUF1129 domain-containing protein -
  DK181_RS09195 (DK182_09195) rpsR 1881630..1881869 (-) 240 WP_002961569.1 30S ribosomal protein S18 -
  DK181_RS09200 (DK182_09200) ssb 1881927..1882409 (-) 483 WP_002961571.1 single-stranded DNA-binding protein Machinery gene
  DK181_RS09205 (DK182_09205) rpsF 1882421..1882711 (-) 291 WP_002961573.1 30S ribosomal protein S6 -
  DK181_RS09210 (DK182_09210) - 1883166..1883837 (-) 672 WP_002961575.1 TMEM175 family protein -
  DK181_RS10835 - 1884003..1884179 (-) 177 WP_169447861.1 hypothetical protein -
  DK181_RS09215 (DK182_09215) - 1884640..1884813 (-) 174 WP_080651904.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  DK181_RS09220 (DK182_09220) cipB 1884833..1885018 (-) 186 WP_019771033.1 hypothetical protein Regulator
  DK181_RS09225 (DK182_09225) - 1885101..1885274 (-) 174 WP_019769835.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  DK181_RS09230 (DK182_09230) cipB 1885296..1885481 (-) 186 WP_019769836.1 hypothetical protein Regulator
  DK181_RS09235 (DK182_09235) - 1885775..1885966 (-) 192 WP_002963416.1 bacteriocin -
  DK181_RS09240 (DK182_09240) - 1886268..1886492 (-) 225 WP_002963417.1 garvicin Q family class II bacteriocin -
  DK181_RS09245 (DK182_09245) - 1886713..1887701 (-) 989 Protein_1755 IS30 family transposase -
  DK181_RS09250 (DK182_09250) comB/nlmE 1887863..1888786 (-) 924 WP_002961554.1 HlyD family efflux transporter periplasmic adaptor subunit Regulator

Sequence


Protein


Download         Length: 61 a.a.        Molecular weight: 6600.32 Da        Isoelectric Point: 4.1024

>NTDB_id=253776 DK181_RS09220 WP_019771033.1 1884833..1885018(-) (cipB) [Streptococcus sobrinus strain SL1]
MNTIAFEKFETVDANSLMAIEGGWFWDNWKGGEWALAGAWALGPGTGIIATGFYNGYNSHG

Nucleotide


Download         Length: 186 bp        

>NTDB_id=253776 DK181_RS09220 WP_019771033.1 1884833..1885018(-) (cipB) [Streptococcus sobrinus strain SL1]
ATGAATACAATTGCATTTGAAAAATTTGAAACTGTTGACGCAAATAGTTTGATGGCCATTGAAGGTGGCTGGTTCTGGGA
TAACTGGAAAGGTGGCGAATGGGCGCTAGCTGGTGCATGGGCACTTGGCCCTGGTACAGGTATCATTGCCACAGGATTCT
ACAACGGATACAATTCACACGGATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

45.098

83.607

0.377


Multiple sequence alignment