Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   DKG78_RS12265 Genome accession   NZ_CP029466
Coordinates   2533266..2533439 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain HM618     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2528266..2538439
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DKG78_RS12250 (DKG78_12445) gcvT 2529079..2530179 (-) 1101 WP_132105373.1 glycine cleavage system aminomethyltransferase GcvT -
  DKG78_RS12255 (DKG78_12450) - 2530603..2532273 (+) 1671 WP_132105375.1 DEAD/DEAH box helicase -
  DKG78_RS12260 (DKG78_12455) - 2532295..2533089 (+) 795 WP_007612541.1 YqhG family protein -
  DKG78_RS12265 (DKG78_12460) sinI 2533266..2533439 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  DKG78_RS12270 (DKG78_12465) sinR 2533473..2533808 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DKG78_RS12275 (DKG78_12470) tasA 2533856..2534641 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  DKG78_RS12280 (DKG78_12475) sipW 2534706..2535290 (-) 585 WP_015240205.1 signal peptidase I SipW -
  DKG78_RS12285 (DKG78_12480) tapA 2535262..2535933 (-) 672 WP_069007150.1 amyloid fiber anchoring/assembly protein TapA -
  DKG78_RS12290 (DKG78_12485) - 2536192..2536521 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  DKG78_RS12295 (DKG78_12490) - 2536562..2536741 (-) 180 WP_003153093.1 YqzE family protein -
  DKG78_RS12300 (DKG78_12495) comGG 2536798..2537175 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  DKG78_RS12305 (DKG78_12500) comGF 2537176..2537676 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  DKG78_RS12310 (DKG78_12505) comGE 2537585..2537899 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  DKG78_RS12315 (DKG78_12510) comGD 2537883..2538320 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=253545 DKG78_RS12265 WP_003153105.1 2533266..2533439(+) (sinI) [Bacillus amyloliquefaciens strain HM618]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=253545 DKG78_RS12265 WP_003153105.1 2533266..2533439(+) (sinI) [Bacillus amyloliquefaciens strain HM618]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702