Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   DKG78_RS02430 Genome accession   NZ_CP029466
Coordinates   469164..469283 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain HM618     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 464164..474283
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DKG78_RS02415 (DKG78_02450) - 465776..466459 (+) 684 WP_007410267.1 response regulator transcription factor -
  DKG78_RS02420 (DKG78_02455) - 466446..467879 (+) 1434 WP_162992601.1 HAMP domain-containing sensor histidine kinase -
  DKG78_RS02425 (DKG78_02460) rapC 468032..469180 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  DKG78_RS02430 (DKG78_02465) phrC 469164..469283 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  DKG78_RS02435 (DKG78_02470) - 469432..469542 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  DKG78_RS02440 (DKG78_02475) - 469622..470986 (-) 1365 WP_020955323.1 aspartate kinase -
  DKG78_RS02445 (DKG78_02480) ceuB 471400..472353 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  DKG78_RS02450 (DKG78_02485) - 472343..473290 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  DKG78_RS02455 (DKG78_02490) - 473284..474042 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=253474 DKG78_RS02430 WP_003156334.1 469164..469283(+) (phrC) [Bacillus amyloliquefaciens strain HM618]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=253474 DKG78_RS02430 WP_003156334.1 469164..469283(+) (phrC) [Bacillus amyloliquefaciens strain HM618]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment