Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   CR535_RS17040 Genome accession   NZ_CP024131
Coordinates   3145361..3145990 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 14EC007     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3124783..3162211 3145361..3145990 within 0


Gene organization within MGE regions


Location: 3124783..3162211
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CR535_RS16885 (CR535_16800) - 3124845..3125108 (-) 264 WP_000224233.1 hypothetical protein -
  CR535_RS16890 (CR535_16805) - 3125110..3125326 (-) 217 Protein_3099 DUF4014 family protein -
  CR535_RS16895 (CR535_16810) - 3125359..3125571 (-) 213 WP_101972958.1 hypothetical protein -
  CR535_RS16900 (CR535_16815) - 3125622..3125978 (-) 357 WP_000403777.1 hypothetical protein -
  CR535_RS16905 (CR535_16820) - 3125956..3126417 (-) 462 WP_101972959.1 sigma-E factor regulatory protein RseB domain-containing protein -
  CR535_RS16910 (CR535_16825) - 3126414..3126710 (-) 297 WP_001266134.1 DUF4406 domain-containing protein -
  CR535_RS16915 (CR535_16830) - 3126707..3127129 (-) 423 WP_001151153.1 DUF977 family protein -
  CR535_RS16920 (CR535_16835) - 3127170..3128240 (-) 1071 WP_001262389.1 hypothetical protein -
  CR535_RS16925 (CR535_16840) - 3128312..3128737 (-) 426 WP_000693949.1 toxin YdaT family protein -
  CR535_RS16930 (CR535_16845) - 3128734..3128949 (-) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  CR535_RS16935 (CR535_16850) - 3128999..3129715 (+) 717 WP_000103686.1 S24 family peptidase -
  CR535_RS16945 (CR535_16860) - 3129988..3130140 (+) 153 WP_000379580.1 DUF1391 family protein -
  CR535_RS16950 (CR535_16865) - 3130152..3130526 (+) 375 WP_000394557.1 hypothetical protein -
  CR535_RS16960 (CR535_16875) dicB 3131055..3131243 (+) 189 WP_000449192.1 cell division inhibition protein DicB -
  CR535_RS16965 (CR535_16880) - 3131240..3131431 (+) 192 WP_001090200.1 DUF1482 family protein -
  CR535_RS16970 (CR535_16885) - 3131524..3133995 (+) 2472 WP_101972960.1 exonuclease -
  CR535_RS16975 (CR535_16890) - 3134063..3134305 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  CR535_RS16980 (CR535_16895) - 3134283..3135302 (+) 1020 WP_001299701.1 tyrosine-type recombinase/integrase -
  CR535_RS16985 (CR535_16900) yccA 3135710..3136369 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  CR535_RS16990 (CR535_16905) tusE 3136460..3136789 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  CR535_RS16995 (CR535_16910) yccX 3136786..3137064 (-) 279 WP_000048252.1 acylphosphatase -
  CR535_RS17000 (CR535_16915) rlmI 3137159..3138349 (+) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  CR535_RS17005 (CR535_16920) hspQ 3138407..3138724 (+) 318 WP_001295356.1 heat shock protein HspQ -
  CR535_RS17010 (CR535_16925) yccU 3138769..3139182 (-) 414 WP_001301418.1 CoA-binding protein -
  CR535_RS17015 (CR535_16930) yccT 3139355..3140017 (+) 663 WP_000847791.1 DUF2057 family protein -
  CR535_RS17020 (CR535_16935) mgsA 3140113..3140571 (+) 459 WP_000424181.1 methylglyoxal synthase -
  CR535_RS17025 (CR535_16940) helD 3140603..3142657 (-) 2055 WP_000420536.1 DNA helicase IV -
  CR535_RS17030 (CR535_16945) yccF 3142780..3143226 (+) 447 WP_001261235.1 YccF domain-containing protein -
  CR535_RS17035 (CR535_16950) yccS 3143236..3145398 (+) 2163 WP_000875061.1 YccS family putative transporter -
  CR535_RS17040 (CR535_16955) sxy/tfoX 3145361..3145990 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  CR535_RS17045 (CR535_16960) sulA 3146209..3146718 (+) 510 WP_000288706.1 SOS-induced cell division inhibitor SulA -
  CR535_RS17055 (CR535_16970) ompA 3147075..3148127 (+) 1053 WP_001361736.1 porin OmpA -
  CR535_RS17060 (CR535_16975) matP 3148203..3148655 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  CR535_RS17065 (CR535_16980) ycbZ 3148841..3150601 (+) 1761 WP_000156518.1 Lon protease family protein -
  CR535_RS17070 (CR535_16985) fabA 3150670..3151188 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  CR535_RS17075 (CR535_16990) rmf 3151258..3151425 (-) 168 WP_000828648.1 ribosome modulation factor -
  CR535_RS17080 (CR535_16995) pqiC 3151681..3152244 (-) 564 WP_000759118.1 membrane integrity-associated transporter subunit PqiC -
  CR535_RS17085 (CR535_17000) pqiB 3152241..3153881 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  CR535_RS17090 (CR535_17005) pqiA 3153886..3155139 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  CR535_RS17095 (CR535_17010) uup 3155269..3157176 (-) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  CR535_RS17100 (CR535_17015) rlmKL 3157187..3159295 (-) 2109 WP_001086517.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  CR535_RS17105 (CR535_17020) ycbX 3159539..3160648 (+) 1110 WP_000224273.1 6-N-hydroxylaminopurine resistance protein YcbX -
  CR535_RS17110 (CR535_17025) zapC 3160645..3161187 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=252448 CR535_RS17040 WP_000839153.1 3145361..3145990(-) (sxy/tfoX) [Escherichia coli strain 14EC007]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=252448 CR535_RS17040 WP_000839153.1 3145361..3145990(-) (sxy/tfoX) [Escherichia coli strain 14EC007]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGATGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment