Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   BXP23_RS07580 Genome accession   NZ_CP024073
Coordinates   1554469..1554582 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 7.13_R1c     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1549469..1559582
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BXP23_RS07560 (BXP23_07555) - 1550135..1551547 (-) 1413 WP_001861341.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  BXP23_RS07565 (BXP23_07560) comB10 1551617..1552753 (-) 1137 WP_001045869.1 DNA type IV secretion system protein ComB10 Machinery gene
  BXP23_RS07570 (BXP23_07565) comB9 1552746..1553729 (-) 984 WP_001861340.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  BXP23_RS07575 (BXP23_07570) comB8 1553729..1554472 (-) 744 WP_000660520.1 type IV secretion system protein Machinery gene
  BXP23_RS07580 (BXP23_07575) comB7 1554469..1554582 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  BXP23_RS07585 (BXP23_07580) comB6 1554598..1555653 (-) 1056 WP_000786677.1 P-type conjugative transfer protein TrbL Machinery gene
  BXP23_RS07590 (BXP23_07585) - 1555661..1556656 (-) 996 WP_000468428.1 PDZ domain-containing protein -
  BXP23_RS07595 (BXP23_07590) - 1556656..1556958 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  BXP23_RS07600 (BXP23_07595) panD 1556961..1557314 (-) 354 WP_000142236.1 aspartate 1-decarboxylase -
  BXP23_RS07605 (BXP23_07600) - 1557304..1559529 (-) 2226 WP_001051506.1 AAA family ATPase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=251568 BXP23_RS07580 WP_001217873.1 1554469..1554582(-) (comB7) [Helicobacter pylori strain 7.13_R1c]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=251568 BXP23_RS07580 WP_001217873.1 1554469..1554582(-) (comB7) [Helicobacter pylori strain 7.13_R1c]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment