Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   DDT09_RS01965 Genome accession   NZ_CP029070
Coordinates   387837..387956 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain ALB69     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 382837..392956
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DDT09_RS01950 (DDT09_01950) - 384449..385132 (+) 684 WP_022552587.1 response regulator transcription factor -
  DDT09_RS01955 (DDT09_01955) - 385119..386546 (+) 1428 WP_089072406.1 HAMP domain-containing sensor histidine kinase -
  DDT09_RS01960 (DDT09_01960) rapC 386705..387853 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  DDT09_RS01965 (DDT09_01965) phrC 387837..387956 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  DDT09_RS01970 (DDT09_01970) - 388108..388203 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  DDT09_RS01975 (DDT09_01975) - 388298..389662 (-) 1365 WP_021495117.1 aspartate kinase -
  DDT09_RS01980 (DDT09_01980) ceuB 390076..391029 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  DDT09_RS01985 (DDT09_01985) - 391019..391966 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  DDT09_RS01990 (DDT09_01990) - 391960..392718 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=250192 DDT09_RS01965 WP_003156334.1 387837..387956(+) (phrC) [Bacillus amyloliquefaciens strain ALB69]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=250192 DDT09_RS01965 WP_003156334.1 387837..387956(+) (phrC) [Bacillus amyloliquefaciens strain ALB69]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment