Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BAALB65_RS12345 | Genome accession | NZ_CP029069 |
| Coordinates | 2516249..2516422 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | - |
| Organism | Bacillus amyloliquefaciens strain ALB65 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2511249..2521422
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAALB65_RS12330 (BAALB65_12330) | gcvT | 2512062..2513162 (-) | 1101 | WP_061890721.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BAALB65_RS12335 (BAALB65_12335) | - | 2513586..2515256 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| BAALB65_RS12340 (BAALB65_12340) | - | 2515278..2516072 (+) | 795 | WP_109567072.1 | YqhG family protein | - |
| BAALB65_RS12345 (BAALB65_12345) | sinI | 2516249..2516422 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| BAALB65_RS12350 (BAALB65_12350) | sinR | 2516456..2516791 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BAALB65_RS12355 (BAALB65_12355) | - | 2516839..2517624 (-) | 786 | WP_109567073.1 | TasA family protein | - |
| BAALB65_RS12360 (BAALB65_12360) | - | 2517689..2518273 (-) | 585 | WP_014418370.1 | signal peptidase I | - |
| BAALB65_RS12365 (BAALB65_12365) | tapA | 2518245..2518916 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BAALB65_RS12370 (BAALB65_12370) | - | 2519175..2519504 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BAALB65_RS12375 (BAALB65_12375) | - | 2519545..2519724 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BAALB65_RS12380 (BAALB65_12380) | comGG | 2519781..2520158 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BAALB65_RS12385 (BAALB65_12385) | comGF | 2520159..2520554 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| BAALB65_RS12390 (BAALB65_12390) | comGE | 2520568..2520882 (-) | 315 | WP_109567074.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BAALB65_RS12395 (BAALB65_12395) | comGD | 2520866..2521303 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=250105 BAALB65_RS12345 WP_014418369.1 2516249..2516422(+) (sinI) [Bacillus amyloliquefaciens strain ALB65]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=250105 BAALB65_RS12345 WP_014418369.1 2516249..2516422(+) (sinI) [Bacillus amyloliquefaciens strain ALB65]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |