Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CPQ91_RS13170 | Genome accession | NZ_CP023729 |
| Coordinates | 2532776..2532952 (+) | Length | 58 a.a. |
| NCBI ID | WP_003183444.1 | Uniprot ID | - |
| Organism | Bacillus licheniformis strain ATCC 9789 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2527776..2537952
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CPQ91_RS13155 (CPQ91_13155) | gcvT | 2528405..2529499 (-) | 1095 | WP_003183436.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CPQ91_RS13160 (CPQ91_13160) | - | 2530105..2531784 (+) | 1680 | WP_003183439.1 | DEAD/DEAH box helicase | - |
| CPQ91_RS13165 (CPQ91_13165) | - | 2531791..2532585 (+) | 795 | WP_061578400.1 | YqhG family protein | - |
| CPQ91_RS13170 (CPQ91_13170) | sinI | 2532776..2532952 (+) | 177 | WP_003183444.1 | anti-repressor SinI | Regulator |
| CPQ91_RS13175 (CPQ91_13175) | sinR | 2532986..2533321 (+) | 336 | WP_006637528.1 | transcriptional regulator SinR | Regulator |
| CPQ91_RS13180 (CPQ91_13180) | tasA | 2533426..2534220 (-) | 795 | WP_003183447.1 | biofilm matrix protein TasA | - |
| CPQ91_RS13185 (CPQ91_13185) | sipW | 2534294..2534878 (-) | 585 | WP_003183449.1 | signal peptidase I SipW | - |
| CPQ91_RS13190 (CPQ91_13190) | tapA | 2534875..2535603 (-) | 729 | WP_061578399.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CPQ91_RS13195 (CPQ91_13195) | - | 2535880..2536200 (+) | 321 | WP_003183454.1 | YqzG/YhdC family protein | - |
| CPQ91_RS13200 (CPQ91_13200) | - | 2536224..2536406 (-) | 183 | WP_003183456.1 | YqzE family protein | - |
| CPQ91_RS13205 (CPQ91_13205) | comGG | 2536495..2536860 (-) | 366 | WP_003183459.1 | competence type IV pilus minor pilin ComGG | - |
| CPQ91_RS13210 (CPQ91_13210) | comGF | 2536873..2537361 (-) | 489 | WP_011201694.1 | competence type IV pilus minor pilin ComGF | - |
| CPQ91_RS13215 (CPQ91_13215) | comGE | 2537270..2537617 (-) | 348 | WP_009327907.1 | competence type IV pilus minor pilin ComGE | - |
Sequence
Protein
Download Length: 58 a.a. Molecular weight: 6724.47 Da Isoelectric Point: 4.7616
>NTDB_id=249592 CPQ91_RS13170 WP_003183444.1 2532776..2532952(+) (sinI) [Bacillus licheniformis strain ATCC 9789]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF
Nucleotide
Download Length: 177 bp
>NTDB_id=249592 CPQ91_RS13170 WP_003183444.1 2532776..2532952(+) (sinI) [Bacillus licheniformis strain ATCC 9789]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
51.724 |
100 |
0.517 |