Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   CP957_RS17340 Genome accession   NZ_CP023673
Coordinates   3130420..3131049 (-) Length   209 a.a.
NCBI ID   WP_032186268.1    Uniprot ID   -
Organism   Escherichia coli strain SMN013SH2     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3105476..3142223 3130420..3131049 within 0


Gene organization within MGE regions


Location: 3105476..3142223
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CP957_RS17165 (CP957_17020) - 3107082..3107855 (-) 774 WP_062881813.1 alpha/beta hydrolase -
  CP957_RS17170 (CP957_17025) hokD 3108460..3108615 (+) 156 WP_000813263.1 type I toxin-antitoxin system toxin HokD -
  CP957_RS17175 (CP957_17030) - 3108783..3109061 (+) 279 WP_074433979.1 hypothetical protein -
  CP957_RS17180 (CP957_17035) - 3109063..3110112 (+) 1050 WP_001265133.1 DUF968 domain-containing protein -
  CP957_RS17185 (CP957_17040) - 3110125..3110496 (+) 372 WP_001217436.1 RusA family crossover junction endodeoxyribonuclease -
  CP957_RS17190 (CP957_17045) - 3110486..3110857 (+) 372 WP_000090265.1 antiterminator Q family protein -
  CP957_RS17195 (CP957_17050) - 3111009..3111827 (+) 819 WP_000265267.1 CPBP family intramembrane glutamic endopeptidase -
  CP957_RS17200 (CP957_17055) - 3112114..3112311 (+) 198 WP_000917737.1 hypothetical protein -
  CP957_RS29410 - 3112446..3112871 (+) 426 WP_176465538.1 hypothetical protein -
  CP957_RS17210 (CP957_17065) - 3112858..3112953 (-) 96 Protein_3185 Rha family transcriptional regulator -
  CP957_RS17215 (CP957_17070) - 3112937..3113209 (-) 273 WP_000887453.1 YdaS family helix-turn-helix protein -
  CP957_RS17220 (CP957_17075) - 3113318..3113719 (+) 402 WP_000986592.1 helix-turn-helix domain-containing protein -
  CP957_RS17225 (CP957_17080) - 3113747..3113938 (+) 192 WP_000536233.1 hypothetical protein -
  CP957_RS17230 (CP957_17085) - 3113938..3114225 (+) 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin -
  CP957_RS17235 (CP957_17095) ydfA 3114502..3114657 (+) 156 WP_000379575.1 DUF1391 family protein -
  CP957_RS30225 (CP957_17100) ydfB 3114659..3114787 (+) 129 WP_000344963.1 protein YdfB -
  CP957_RS17245 (CP957_17105) - 3114799..3115188 (+) 390 WP_032205089.1 hypothetical protein -
  CP957_RS17250 (CP957_17110) - 3115375..3115560 (-) 186 WP_032205087.1 hypothetical protein -
  CP957_RS17260 (CP957_17120) dicB 3116134..3116322 (+) 189 WP_000413705.1 cell division inhibition protein DicB -
  CP957_RS17265 (CP957_17125) - 3116319..3116510 (+) 192 WP_001098307.1 DUF1482 family protein -
  CP957_RS17270 (CP957_17130) - 3116604..3119054 (+) 2451 WP_009448824.1 exonuclease -
  CP957_RS17275 (CP957_17135) - 3119122..3119364 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  CP957_RS17280 (CP957_17140) - 3119342..3120361 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  CP957_RS17285 (CP957_17145) yccA 3120769..3121428 (+) 660 WP_062882278.1 FtsH protease modulator YccA -
  CP957_RS17290 (CP957_17150) tusE 3121519..3121848 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  CP957_RS17295 (CP957_17155) yccX 3121845..3122123 (-) 279 WP_000048252.1 acylphosphatase -
  CP957_RS17300 (CP957_17160) rlmI 3122218..3123408 (+) 1191 WP_062882280.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  CP957_RS17305 (CP957_17165) hspQ 3123466..3123783 (+) 318 WP_001295356.1 heat shock protein HspQ -
  CP957_RS17310 (CP957_17170) yccU 3123828..3124241 (-) 414 WP_001343235.1 CoA-binding protein -
  CP957_RS17315 (CP957_17175) yccT 3124414..3125076 (+) 663 WP_060616790.1 DUF2057 family protein -
  CP957_RS17320 (CP957_17180) mgsA 3125172..3125630 (+) 459 WP_000424181.1 methylglyoxal synthase -
  CP957_RS17325 (CP957_17185) helD 3125662..3127716 (-) 2055 WP_000420537.1 DNA helicase IV -
  CP957_RS17330 (CP957_17190) yccF 3127839..3128285 (+) 447 WP_062882281.1 YccF domain-containing protein -
  CP957_RS17335 (CP957_17195) yccS 3128295..3130457 (+) 2163 WP_074434046.1 YccS family putative transporter -
  CP957_RS17340 (CP957_17200) sxy/tfoX 3130420..3131049 (-) 630 WP_032186268.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  CP957_RS17345 (CP957_17205) sulA 3131268..3131777 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  CP957_RS17355 (CP957_17215) ompA 3132134..3133174 (+) 1041 WP_062882317.1 porin OmpA -
  CP957_RS17360 (CP957_17220) matP 3133250..3133702 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  CP957_RS17365 (CP957_17225) ycbZ 3133888..3135648 (+) 1761 WP_062882282.1 Lon protease family protein -
  CP957_RS17370 (CP957_17230) fabA 3135717..3136235 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  CP957_RS17375 (CP957_17235) rmf 3136305..3136472 (-) 168 WP_000828648.1 ribosome modulation factor -
  CP957_RS17380 (CP957_17240) pqiC 3136728..3137291 (-) 564 WP_000759129.1 membrane integrity-associated transporter subunit PqiC -
  CP957_RS17385 (CP957_17245) pqiB 3137288..3138928 (-) 1641 WP_000445561.1 intermembrane transport protein PqiB -
  CP957_RS17390 (CP957_17250) pqiA 3138933..3140186 (-) 1254 WP_062882283.1 membrane integrity-associated transporter subunit PqiA -
  CP957_RS17395 (CP957_17255) uup 3140316..3142223 (-) 1908 WP_062882284.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24177.04 Da        Isoelectric Point: 8.9883

>NTDB_id=249212 CP957_RS17340 WP_032186268.1 3130420..3131049(-) (sxy/tfoX) [Escherichia coli strain SMN013SH2]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLWQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=249212 CP957_RS17340 WP_032186268.1 3130420..3131049(-) (sxy/tfoX) [Escherichia coli strain SMN013SH2]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGTGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995


Multiple sequence alignment