Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CP942_RS20640 Genome accession   NZ_CP023666
Coordinates   4117802..4117978 (-) Length   58 a.a.
NCBI ID   WP_096748221.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain Bac48     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 4112802..4122978
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CP942_RS22935 comGF 4113133..4113876 (+) 744 WP_234025536.1 competence type IV pilus minor pilin ComGF -
  CP942_RS20605 comGG 4113888..4114253 (+) 366 WP_105980341.1 competence type IV pilus minor pilin ComGG -
  CP942_RS20610 - 4114342..4114524 (+) 183 WP_020452171.1 YqzE family protein -
  CP942_RS20615 - 4114554..4114874 (-) 321 WP_023855188.1 YqzG/YhdC family protein -
  CP942_RS20620 tapA 4115152..4115880 (+) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  CP942_RS20625 sipW 4115877..4116461 (+) 585 WP_105980343.1 signal peptidase I SipW -
  CP942_RS20630 tasA 4116534..4117328 (+) 795 WP_020452167.1 biofilm matrix protein TasA -
  CP942_RS20635 sinR 4117433..4117768 (-) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  CP942_RS20640 sinI 4117802..4117978 (-) 177 WP_096748221.1 anti-repressor SinI Regulator
  CP942_RS20645 - 4118169..4118963 (-) 795 WP_020452164.1 YqhG family protein -
  CP942_RS20650 - 4118970..4120649 (-) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  CP942_RS20655 gcvT 4121244..4122338 (+) 1095 WP_105980345.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6708.52 Da        Isoelectric Point: 5.0775

>NTDB_id=249140 CP942_RS20640 WP_096748221.1 4117802..4117978(-) (sinI) [Bacillus paralicheniformis strain Bac48]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=249140 CP942_RS20640 WP_096748221.1 4117802..4117978(-) (sinI) [Bacillus paralicheniformis strain Bac48]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment