Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   CLI98_RS04740 Genome accession   NZ_CP023431
Coordinates   922467..922607 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SCGB 574     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 917467..927607
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLI98_RS04715 (CLI98_00930) - 917807..918190 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  CLI98_RS04720 (CLI98_00931) comA 918212..918856 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  CLI98_RS04725 (CLI98_00932) comP 918937..921228 (-) 2292 WP_022553709.1 histidine kinase Regulator
  CLI98_RS04730 (CLI98_00933) comX 921240..921404 (-) 165 WP_007613432.1 competence pheromone ComX -
  CLI98_RS04735 (CLI98_00934) - 921404..922282 (-) 879 WP_032860494.1 polyprenyl synthetase family protein -
  CLI98_RS04740 (CLI98_00935) degQ 922467..922607 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CLI98_RS04750 (CLI98_00936) - 923073..923414 (+) 342 WP_014418765.1 hypothetical protein -
  CLI98_RS04755 (CLI98_00937) - 923421..924644 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  CLI98_RS04760 (CLI98_00938) - 924774..926240 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  CLI98_RS04765 (CLI98_00939) - 926258..926809 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  CLI98_RS04770 (CLI98_00940) - 926906..927304 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=247060 CLI98_RS04740 WP_003152043.1 922467..922607(-) (degQ) [Bacillus velezensis strain SCGB 574]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=247060 CLI98_RS04740 WP_003152043.1 922467..922607(-) (degQ) [Bacillus velezensis strain SCGB 574]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment