Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CMV18_RS05800 Genome accession   NZ_CP023341
Coordinates   1100892..1101032 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain LG37     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1095892..1106032
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CMV18_RS05770 (CMV18_05750) - 1096195..1096593 (+) 399 WP_003152031.1 YueI family protein -
  CMV18_RS05775 (CMV18_05755) - 1096690..1097241 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  CMV18_RS05780 (CMV18_05760) - 1097259..1098725 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  CMV18_RS05785 (CMV18_05765) - 1098855..1100078 (+) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  CMV18_RS05790 (CMV18_05770) - 1100085..1100426 (-) 342 WP_032876795.1 hypothetical protein -
  CMV18_RS05800 (CMV18_05780) degQ 1100892..1101032 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CMV18_RS05805 (CMV18_05785) - 1101240..1102100 (+) 861 WP_142925231.1 polyprenyl synthetase family protein -
  CMV18_RS05810 (CMV18_05790) comX 1102069..1102242 (+) 174 WP_012118314.1 competence pheromone ComX -
  CMV18_RS05815 (CMV18_05795) comP 1102256..1104556 (+) 2301 WP_032876801.1 histidine kinase Regulator
  CMV18_RS05820 (CMV18_05800) comA 1104637..1105281 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  CMV18_RS05825 (CMV18_05805) - 1105303..1105686 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=246138 CMV18_RS05800 WP_003152043.1 1100892..1101032(+) (degQ) [Bacillus velezensis strain LG37]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=246138 CMV18_RS05800 WP_003152043.1 1100892..1101032(+) (degQ) [Bacillus velezensis strain LG37]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment