Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   CLI97_RS12610 Genome accession   NZ_CP023320
Coordinates   2397240..2397359 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SCGB     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 2392240..2402359
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLI97_RS12595 (CLI97_02488) - 2393852..2394535 (+) 684 WP_094247243.1 response regulator transcription factor -
  CLI97_RS12600 (CLI97_02489) - 2394522..2395955 (+) 1434 WP_161941456.1 HAMP domain-containing sensor histidine kinase -
  CLI97_RS12605 (CLI97_02490) rapC 2396108..2397256 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  CLI97_RS12610 (CLI97_02491) phrC 2397240..2397359 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  CLI97_RS12615 - 2397509..2397619 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  CLI97_RS12620 (CLI97_02492) - 2397699..2399063 (-) 1365 WP_070081361.1 aspartate kinase -
  CLI97_RS12625 (CLI97_02493) ceuB 2399478..2400431 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  CLI97_RS12630 (CLI97_02494) - 2400421..2401368 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  CLI97_RS12635 (CLI97_02495) - 2401362..2402120 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=246053 CLI97_RS12610 WP_003156334.1 2397240..2397359(+) (phrC) [Bacillus velezensis strain SCGB]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=246053 CLI97_RS12610 WP_003156334.1 2397240..2397359(+) (phrC) [Bacillus velezensis strain SCGB]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment