Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   CJ306_RS13590 Genome accession   NZ_CP023245
Coordinates   2631273..2631551 (+) Length   92 a.a.
NCBI ID   WP_119683433.1    Uniprot ID   -
Organism   Bacillus cereus strain HBL-AI     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2621214..2665750 2631273..2631551 within 0


Gene organization within MGE regions


Location: 2621214..2665750
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJ306_RS13530 (CJ306_13875) tenA 2621214..2621903 (+) 690 WP_001011746.1 thiaminase II -
  CJ306_RS13540 (CJ306_13885) - 2622301..2622564 (+) 264 WP_002183611.1 DUF3937 family protein -
  CJ306_RS13545 (CJ306_13890) - 2623123..2623452 (+) 330 WP_119683429.1 heterocycloanthracin/sonorensin family bacteriocin -
  CJ306_RS31305 - 2623602..2623736 (+) 135 Protein_2572 site-specific integrase -
  CJ306_RS13550 (CJ306_13895) - 2623946..2624431 (+) 486 WP_002183612.1 hypothetical protein -
  CJ306_RS13555 (CJ306_13900) - 2624743..2625444 (+) 702 WP_119683430.1 DUF3962 domain-containing protein -
  CJ306_RS13560 (CJ306_13905) - 2625483..2626592 (-) 1110 WP_119683431.1 tyrosine-type recombinase/integrase -
  CJ306_RS13565 (CJ306_13910) - 2627197..2628405 (+) 1209 WP_089607485.1 AimR family lysis-lysogeny pheromone receptor -
  CJ306_RS31085 - 2628432..2628587 (+) 156 WP_162900577.1 hypothetical protein -
  CJ306_RS13570 (CJ306_13915) - 2628851..2629201 (-) 351 WP_000367267.1 helix-turn-helix transcriptional regulator -
  CJ306_RS13575 (CJ306_13920) - 2629388..2629612 (+) 225 WP_001192731.1 helix-turn-helix transcriptional regulator -
  CJ306_RS13580 (CJ306_13925) - 2629653..2629919 (+) 267 WP_000522182.1 helix-turn-helix domain-containing protein -
  CJ306_RS13585 (CJ306_13940) - 2630295..2631269 (+) 975 WP_119683432.1 DnaD domain protein -
  CJ306_RS13590 (CJ306_13945) abrB 2631273..2631551 (+) 279 WP_119683433.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  CJ306_RS13595 (CJ306_13950) - 2631544..2631903 (+) 360 WP_089607489.1 cell division protein SepF -
  CJ306_RS13600 (CJ306_13955) - 2631923..2632090 (+) 168 WP_080470708.1 DUF3954 domain-containing protein -
  CJ306_RS13605 (CJ306_13960) - 2632116..2632367 (+) 252 WP_089607490.1 helix-turn-helix domain containing protein -
  CJ306_RS13610 (CJ306_13965) - 2632387..2632842 (+) 456 WP_089607491.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  CJ306_RS13620 (CJ306_13975) - 2635145..2636461 (+) 1317 WP_119683434.1 exosporium glycoprotein BclB-related protein -
  CJ306_RS13625 (CJ306_13980) - 2636782..2637018 (+) 237 WP_119683435.1 hypothetical protein -
  CJ306_RS13630 (CJ306_13985) - 2637047..2637778 (-) 732 WP_240440598.1 glycosyltransferase family 2 protein -
  CJ306_RS13635 (CJ306_13990) - 2638021..2638485 (-) 465 WP_088338598.1 exosporium protein D -
  CJ306_RS31865 - 2639044..2639310 (+) 267 Protein_2591 hypothetical protein -
  CJ306_RS13650 (CJ306_14005) - 2640050..2640349 (+) 300 WP_061884838.1 hypothetical protein -
  CJ306_RS13655 (CJ306_14010) - 2640693..2641067 (+) 375 WP_119683436.1 hypothetical protein -
  CJ306_RS13660 (CJ306_14015) - 2641967..2642182 (-) 216 WP_119683437.1 spore germination protein -
  CJ306_RS31095 (CJ306_14020) - 2642432..2642602 (+) 171 WP_162900590.1 hypothetical protein -
  CJ306_RS13665 (CJ306_14025) - 2642630..2643112 (+) 483 WP_119683438.1 ArpU family phage packaging/lysis transcriptional regulator -
  CJ306_RS13670 (CJ306_14030) - 2643112..2643654 (+) 543 WP_119683439.1 site-specific integrase -
  CJ306_RS13675 (CJ306_14035) - 2643862..2644827 (+) 966 WP_240440591.1 hypothetical protein -
  CJ306_RS13680 (CJ306_14040) - 2645188..2645397 (+) 210 WP_097820533.1 hypothetical protein -
  CJ306_RS13685 (CJ306_14045) - 2645536..2645790 (+) 255 WP_119683440.1 hypothetical protein -
  CJ306_RS13690 (CJ306_14050) - 2645780..2646157 (+) 378 WP_119683441.1 HNH endonuclease -
  CJ306_RS13695 (CJ306_14055) - 2646287..2646790 (+) 504 WP_119683442.1 phage terminase small subunit P27 family -
  CJ306_RS13700 (CJ306_14060) - 2646792..2648486 (+) 1695 WP_119683443.1 terminase TerL endonuclease subunit -
  CJ306_RS13705 (CJ306_14065) - 2648675..2649928 (+) 1254 WP_119683444.1 phage portal protein -
  CJ306_RS13710 (CJ306_14070) - 2649915..2650625 (+) 711 WP_119683445.1 head maturation protease, ClpP-related -
  CJ306_RS13715 (CJ306_14075) - 2650663..2651835 (+) 1173 WP_119683446.1 phage major capsid protein -
  CJ306_RS13720 (CJ306_14080) - 2651856..2652143 (+) 288 WP_119683447.1 head-tail connector protein -
  CJ306_RS13725 (CJ306_14085) - 2652130..2652453 (+) 324 WP_119683448.1 phage head closure protein -
  CJ306_RS13730 (CJ306_14090) - 2652446..2652883 (+) 438 WP_119683449.1 HK97-gp10 family putative phage morphogenesis protein -
  CJ306_RS13735 (CJ306_14095) - 2652880..2653239 (+) 360 WP_119683450.1 DUF3168 domain-containing protein -
  CJ306_RS13740 (CJ306_14100) - 2653240..2653845 (+) 606 WP_119683451.1 major tail protein -
  CJ306_RS13745 (CJ306_14105) - 2653894..2654211 (+) 318 WP_119683452.1 hypothetical protein -
  CJ306_RS31100 - 2654241..2654417 (+) 177 WP_162900591.1 hypothetical protein -
  CJ306_RS13750 (CJ306_14110) - 2654432..2658280 (+) 3849 WP_119683453.1 phage tail tape measure protein -
  CJ306_RS13755 (CJ306_14115) - 2658295..2659767 (+) 1473 WP_098376220.1 distal tail protein Dit -
  CJ306_RS13760 (CJ306_14120) - 2659764..2664080 (+) 4317 WP_119683454.1 phage tail spike protein -
  CJ306_RS13765 (CJ306_14125) - 2664092..2664472 (+) 381 WP_119683455.1 hypothetical protein -
  CJ306_RS13770 (CJ306_14130) - 2664507..2664932 (+) 426 WP_119683456.1 phage holin family protein -
  CJ306_RS13775 (CJ306_14135) - 2664932..2665750 (+) 819 WP_119683457.1 GH25 family lysozyme -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10064.67 Da        Isoelectric Point: 5.7122

>NTDB_id=245369 CJ306_RS13590 WP_119683433.1 2631273..2631551(+) (abrB) [Bacillus cereus strain HBL-AI]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKQDKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=245369 CJ306_RS13590 WP_119683433.1 2631273..2631551(+) (abrB) [Bacillus cereus strain HBL-AI]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTTTAAGAAAACAAGATAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAATTGCTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCTATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-48)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

59.77

94.565

0.565

Multiple sequence alignment