Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CK945_RS14505 Genome accession   NZ_CP023168
Coordinates   2815946..2816122 (+) Length   58 a.a.
NCBI ID   WP_096748221.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain 14DA11     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2810946..2821122
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CK945_RS14485 gcvT 2811586..2812680 (-) 1095 WP_020452162.1 glycine cleavage system aminomethyltransferase GcvT -
  CK945_RS14495 - 2813275..2814954 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  CK945_RS14500 - 2814961..2815755 (+) 795 WP_020452164.1 YqhG family protein -
  CK945_RS14505 sinI 2815946..2816122 (+) 177 WP_096748221.1 anti-repressor SinI Regulator
  CK945_RS14510 sinR 2816156..2816491 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  CK945_RS14515 tasA 2816596..2817390 (-) 795 WP_048349970.1 biofilm matrix protein TasA -
  CK945_RS14520 sipW 2817463..2818047 (-) 585 WP_065644169.1 signal peptidase I SipW -
  CK945_RS14525 tapA 2818044..2818772 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  CK945_RS14530 - 2819050..2819370 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  CK945_RS14535 - 2819400..2819582 (-) 183 WP_025811164.1 YqzE family protein -
  CK945_RS14540 comGG 2819671..2820036 (-) 366 WP_025811163.1 competence type IV pilus minor pilin ComGG -
  CK945_RS14545 comGF 2820048..2820536 (-) 489 WP_229078638.1 competence type IV pilus minor pilin ComGF -
  CK945_RS14550 comGE 2820445..2820792 (-) 348 WP_025811161.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6708.52 Da        Isoelectric Point: 5.0775

>NTDB_id=245114 CK945_RS14505 WP_096748221.1 2815946..2816122(+) (sinI) [Bacillus paralicheniformis strain 14DA11]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=245114 CK945_RS14505 WP_096748221.1 2815946..2816122(+) (sinI) [Bacillus paralicheniformis strain 14DA11]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment