Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   CJZ71_RS06645 Genome accession   NZ_CP022891
Coordinates   1208731..1208871 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain DKU_NT_03     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1203731..1213871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJZ71_RS06620 (CJZ71_06620) yuxO 1204008..1204388 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  CJZ71_RS06625 (CJZ71_06625) comA 1204407..1205051 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  CJZ71_RS06630 (CJZ71_06630) comP 1205132..1207444 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  CJZ71_RS06635 (CJZ71_06635) comX 1207460..1207681 (-) 222 WP_014480704.1 competence pheromone ComX -
  CJZ71_RS06640 (CJZ71_06640) - 1207683..1208546 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  CJZ71_RS06645 (CJZ71_06645) degQ 1208731..1208871 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  CJZ71_RS22395 - 1209093..1209218 (+) 126 WP_003228793.1 hypothetical protein -
  CJZ71_RS06650 (CJZ71_06650) - 1209333..1209701 (+) 369 WP_046381300.1 hypothetical protein -
  CJZ71_RS06655 (CJZ71_06655) pdeH 1209677..1210906 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  CJZ71_RS06660 (CJZ71_06660) pncB 1211042..1212514 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  CJZ71_RS06665 (CJZ71_06665) pncA 1212530..1213081 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  CJZ71_RS06670 (CJZ71_06670) yueI 1213178..1213576 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=242626 CJZ71_RS06645 WP_003220708.1 1208731..1208871(-) (degQ) [Bacillus subtilis strain DKU_NT_03]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=242626 CJZ71_RS06645 WP_003220708.1 1208731..1208871(-) (degQ) [Bacillus subtilis strain DKU_NT_03]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment