Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | CJZ71_RS03695 | Genome accession | NZ_CP022891 |
| Coordinates | 638684..639094 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain DKU_NT_03 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 634051..671325 | 638684..639094 | within | 0 |
Gene organization within MGE regions
Location: 634051..671325
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CJZ71_RS03670 (CJZ71_03670) | yqeF | 634218..634949 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| CJZ71_RS03675 (CJZ71_03675) | cwlH | 635201..635953 (-) | 753 | WP_069837642.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| CJZ71_RS03680 (CJZ71_03680) | yqeD | 636140..636766 (+) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| CJZ71_RS03685 (CJZ71_03685) | gnd | 636785..637678 (-) | 894 | WP_069837643.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| CJZ71_RS03690 (CJZ71_03690) | yqeB | 637929..638651 (+) | 723 | WP_014480321.1 | hypothetical protein | - |
| CJZ71_RS03695 (CJZ71_03695) | nucA/comI | 638684..639094 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| CJZ71_RS03700 (CJZ71_03700) | sigK | 639290..640018 (+) | 729 | WP_013308023.1 | RNA polymerase sporulation sigma factor SigK | - |
| CJZ71_RS22310 | - | 640018..640116 (+) | 99 | WP_031600702.1 | hypothetical protein | - |
| CJZ71_RS22760 (CJZ71_03705) | - | 640113..640325 (-) | 213 | Protein_735 | recombinase family protein | - |
| CJZ71_RS03710 (CJZ71_03710) | fumC | 640544..641932 (-) | 1389 | WP_014480325.1 | class II fumarate hydratase | - |
| CJZ71_RS03715 (CJZ71_03715) | - | 642099..642989 (+) | 891 | WP_014480326.1 | LysR family transcriptional regulator | - |
| CJZ71_RS03720 (CJZ71_03720) | - | 643931..644326 (+) | 396 | WP_014480327.1 | VOC family protein | - |
| CJZ71_RS03730 (CJZ71_03730) | - | 645065..646192 (-) | 1128 | WP_014480328.1 | Rap family tetratricopeptide repeat protein | - |
| CJZ71_RS23060 (CJZ71_03735) | - | 646374..648300 (+) | 1927 | Protein_740 | T7SS effector LXG polymorphic toxin | - |
| CJZ71_RS03740 (CJZ71_03740) | - | 648314..648601 (+) | 288 | WP_014480331.1 | hypothetical protein | - |
| CJZ71_RS03745 (CJZ71_03745) | - | 649004..649444 (+) | 441 | WP_014480332.1 | SMI1/KNR4 family protein | - |
| CJZ71_RS03750 (CJZ71_03750) | - | 649543..649995 (+) | 453 | WP_014480333.1 | SMI1/KNR4 family protein | - |
| CJZ71_RS03755 (CJZ71_03755) | cdiI | 650092..650451 (+) | 360 | WP_014480334.1 | ribonuclease toxin immunity protein CdiI | - |
| CJZ71_RS03760 (CJZ71_03760) | - | 650556..651035 (+) | 480 | WP_224588637.1 | hypothetical protein | - |
| CJZ71_RS22320 | - | 651339..651542 (-) | 204 | WP_123772462.1 | hypothetical protein | - |
| CJZ71_RS03765 (CJZ71_03765) | - | 651622..651855 (+) | 234 | WP_224588641.1 | hypothetical protein | - |
| CJZ71_RS03770 (CJZ71_03770) | atxG | 652112..652689 (+) | 578 | Protein_748 | suppressor of fused domain protein | - |
| CJZ71_RS03775 (CJZ71_03775) | - | 652799..653089 (+) | 291 | WP_014480337.1 | contact-dependent growth inhibition system immunity protein | - |
| CJZ71_RS03785 (CJZ71_03785) | istA | 653930..655477 (+) | 1548 | WP_014480339.1 | IS21 family transposase | - |
| CJZ71_RS03790 (CJZ71_03790) | istB | 655474..656232 (+) | 759 | WP_014479891.1 | IS21-like element helper ATPase IstB | - |
| CJZ71_RS22780 | - | 656550..656647 (-) | 98 | Protein_752 | N-acetylmuramoyl-L-alanine amidase | - |
| CJZ71_RS03800 (CJZ71_03800) | - | 656852..656911 (+) | 60 | WP_076458313.1 | putative holin-like toxin | - |
| CJZ71_RS23140 (CJZ71_03805) | - | 657198..657634 (-) | 437 | Protein_754 | phage tail tube protein | - |
| CJZ71_RS22550 | terS | 657632..658197 (-) | 566 | Protein_755 | phage terminase small subunit | - |
| CJZ71_RS22325 | - | 658324..658629 (+) | 306 | WP_123772463.1 | hypothetical protein | - |
| CJZ71_RS22795 | - | 658802..658867 (-) | 66 | Protein_757 | hypothetical protein | - |
| CJZ71_RS03815 (CJZ71_03815) | - | 659022..659501 (-) | 480 | WP_014480344.1 | hypothetical protein | - |
| CJZ71_RS03820 (CJZ71_03820) | - | 660118..660384 (+) | 267 | WP_033881358.1 | hypothetical protein | - |
| CJZ71_RS03825 (CJZ71_03825) | - | 660523..660675 (-) | 153 | WP_049832653.1 | XtrA/YqaO family protein | - |
| CJZ71_RS03830 (CJZ71_03830) | - | 660758..660880 (-) | 123 | Protein_761 | RusA family crossover junction endodeoxyribonuclease | - |
| CJZ71_RS03835 (CJZ71_03835) | - | 660843..661091 (-) | 249 | Protein_762 | hypothetical protein | - |
| CJZ71_RS22800 | - | 661236..661466 (-) | 231 | WP_224588644.1 | hypothetical protein | - |
| CJZ71_RS03845 (CJZ71_03845) | - | 661775..661955 (-) | 181 | Protein_764 | hypothetical protein | - |
| CJZ71_RS03850 (CJZ71_03850) | bltR | 662163..662984 (-) | 822 | WP_014480349.1 | multidrug efflux transcriptional regulator BltR | - |
| CJZ71_RS03855 (CJZ71_03855) | blt | 663101..664303 (+) | 1203 | WP_029727180.1 | multidrug efflux MFS transporter Blt | - |
| CJZ71_RS03860 (CJZ71_03860) | bltD | 664472..664930 (+) | 459 | WP_015714357.1 | spermine/spermidine acetyltransferase | - |
| CJZ71_RS03865 (CJZ71_03865) | - | 664963..666210 (-) | 1248 | WP_031600262.1 | IS256-like element ISBsu2 family transposase | - |
| CJZ71_RS03870 (CJZ71_03870) | yrkA | 666456..667760 (-) | 1305 | WP_019712547.1 | hemolysin family protein | - |
| CJZ71_RS03875 (CJZ71_03875) | yrzO | 668050..668193 (-) | 144 | WP_014477437.1 | YrzO family protein | - |
| CJZ71_RS03880 (CJZ71_03880) | yrdR | 668211..669176 (-) | 966 | WP_014480354.1 | DMT family transporter | - |
| CJZ71_RS03885 (CJZ71_03885) | czcR | 669302..670168 (+) | 867 | WP_014480355.1 | LysR family transcriptional regulator CzcR | - |
| CJZ71_RS03890 (CJZ71_03890) | czcO | 670288..671325 (-) | 1038 | WP_069837644.1 | NAD(P)/FAD-dependent oxidoreductase | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=242615 CJZ71_RS03695 WP_009967785.1 638684..639094(-) (nucA/comI) [Bacillus subtilis strain DKU_NT_03]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=242615 CJZ71_RS03695 WP_009967785.1 638684..639094(-) (nucA/comI) [Bacillus subtilis strain DKU_NT_03]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |