Detailed information    

insolico Bioinformatically predicted

Overview

Name   mecA   Type   Regulator
Locus tag   CJZ70_RS13980 Genome accession   NZ_CP022890
Coordinates   2635675..2636331 (-) Length   218 a.a.
NCBI ID   WP_015383354.1    Uniprot ID   -
Organism   Bacillus subtilis strain DKU_NT_02     
Function   degradation of ComK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2605869..2645668 2635675..2636331 within 0


Gene organization within MGE regions


Location: 2605869..2645668
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJZ70_RS13790 (CJZ70_13790) yjcH 2606023..2606745 (+) 723 WP_003245358.1 esterase family protein -
  CJZ70_RS13795 (CJZ70_13795) cpdG 2606782..2607297 (+) 516 WP_003232861.1 YjcG family protein -
  CJZ70_RS13800 (CJZ70_13800) yjcF 2607301..2607723 (+) 423 WP_014479473.1 GNAT family N-acetyltransferase -
  CJZ70_RS13805 (CJZ70_13805) - 2607878..2609028 (+) 1151 WP_087614160.1 IS3 family transposase -
  CJZ70_RS13810 (CJZ70_13810) - 2609085..2609339 (-) 255 WP_003232866.1 hypothetical protein -
  CJZ70_RS13815 (CJZ70_13815) yjcD 2609456..2611735 (+) 2280 WP_014479472.1 ATP-dependent helicase -
  CJZ70_RS13820 (CJZ70_13820) spoVIF 2611809..2612063 (-) 255 WP_014479471.1 sporulation-specific transcription regulator SopVIF -
  CJZ70_RS13825 (CJZ70_13825) yjcZ 2612196..2612345 (-) 150 WP_003232872.1 sporulation protein YjcZ -
  CJZ70_RS13830 (CJZ70_13830) - 2612427..2612633 (-) 207 WP_014479470.1 hypothetical protein -
  CJZ70_RS13835 (CJZ70_13835) yjcA 2612915..2613271 (-) 357 WP_014476457.1 sporulation protein YjcA -
  CJZ70_RS13840 (CJZ70_13840) - 2613431..2613817 (+) 387 WP_014479468.1 spore coat protein -
  CJZ70_RS13845 (CJZ70_13845) - 2613857..2614177 (+) 321 WP_014479467.1 hypothetical protein -
  CJZ70_RS13850 (CJZ70_13850) - 2614262..2614744 (+) 483 WP_014479466.1 spore coat protein -
  CJZ70_RS13855 (CJZ70_13855) cotY 2614896..2615384 (+) 489 WP_003239243.1 spore coat protein CotY -
  CJZ70_RS13860 (CJZ70_13860) cotZ 2615512..2615958 (+) 447 WP_003244982.1 spore coat protein CotZ -
  CJZ70_RS13865 (CJZ70_13865) cotO 2616052..2616735 (-) 684 WP_080478405.1 spore coat protein CotO -
  CJZ70_RS13870 (CJZ70_13870) fabI 2616836..2617612 (-) 777 WP_003232896.1 enoyl-ACP reductase FabI -
  CJZ70_RS13875 (CJZ70_13875) thiD 2617748..2618563 (-) 816 WP_014479462.1 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase -
  CJZ70_RS13880 (CJZ70_13880) thiF 2618582..2619592 (-) 1011 WP_046160283.1 thiazole biosynthesis adenylyltransferase ThiF -
  CJZ70_RS13885 (CJZ70_13885) thiG 2619589..2620359 (-) 771 WP_010886483.1 thiazole synthase -
  CJZ70_RS13890 (CJZ70_13890) thiS 2620356..2620556 (-) 201 WP_072173897.1 sulfur carrier protein ThiS -
  CJZ70_RS13895 (CJZ70_13895) thiO 2620556..2621665 (-) 1110 WP_095010698.1 glycine oxidase ThiO -
  CJZ70_RS13900 (CJZ70_13900) tenI 2621649..2622265 (-) 617 Protein_2762 thiazole tautomerase TenI -
  CJZ70_RS13905 (CJZ70_13905) tenA 2622240..2622950 (-) 711 WP_095010699.1 thiaminase II -
  CJZ70_RS13910 (CJZ70_13910) kefQ 2623199..2625043 (-) 1845 WP_087614506.1 monovalent cation:proton antiporter family protein -
  CJZ70_RS13915 (CJZ70_13915) prpE 2625278..2626012 (+) 735 WP_003232912.1 bis(5'-nucleosyl)-tetraphosphatase PrpE -
  CJZ70_RS13920 (CJZ70_13920) rluO 2626025..2626924 (-) 900 WP_014479454.1 RluA family pseudouridine synthase -
  CJZ70_RS13925 (CJZ70_13925) ppnKA 2626939..2627739 (-) 801 WP_003232918.1 NAD kinase -
  CJZ70_RS13930 (CJZ70_13930) yjbM 2627758..2628393 (-) 636 WP_003245294.1 GTP diphosphokinase -
  CJZ70_RS13935 (CJZ70_13935) - 2628422..2628790 (-) 369 WP_014479453.1 hypothetical protein -
  CJZ70_RS13940 (CJZ70_13940) yjbK 2628915..2629487 (+) 573 WP_014479452.1 CYTH domain-containing protein -
  CJZ70_RS13945 (CJZ70_13945) cwlQ 2629502..2630236 (+) 735 WP_014479451.1 bifunctional muramidase/murein lytic transglycosylase -
  CJZ70_RS13950 (CJZ70_13950) bhbI 2630491..2630889 (+) 399 WP_003232928.1 group 2 truncated hemoglobin YjbI -
  CJZ70_RS13955 (CJZ70_13955) spxH 2630886..2631785 (+) 900 WP_003245184.1 protease adaptor protein SpxH -
  CJZ70_RS13965 (CJZ70_13965) - 2632100..2632267 (+) 168 WP_003244944.1 hypothetical protein -
  CJZ70_RS13970 (CJZ70_13970) pepF 2632305..2634134 (-) 1830 WP_173401378.1 oligoendopeptidase F -
  CJZ70_RS13975 (CJZ70_13975) coiA 2634364..2635515 (-) 1152 WP_046380934.1 competence protein CoiA Machinery gene
  CJZ70_RS21260 - 2635559..2635680 (+) 122 Protein_2777 hypothetical protein -
  CJZ70_RS13980 (CJZ70_13980) mecA 2635675..2636331 (-) 657 WP_015383354.1 adaptor protein MecA Regulator
  CJZ70_RS21265 - 2636298..2636438 (-) 141 WP_119122854.1 hypothetical protein -
  CJZ70_RS13985 (CJZ70_13985) yjbE 2636608..2637264 (+) 657 WP_014479447.1 TerC family protein -
  CJZ70_RS13990 (CJZ70_13990) spx 2637307..2637702 (-) 396 WP_014476435.1 transcriptional regulator Spx -
  CJZ70_RS13995 (CJZ70_13995) yjbC 2637883..2638461 (-) 579 WP_003224597.1 GNAT family N-acetyltransferase -
  CJZ70_RS14000 (CJZ70_14000) yjbB 2638625..2639842 (-) 1218 WP_095010820.1 MFS transporter -
  CJZ70_RS14005 (CJZ70_14005) oppF 2639950..2640867 (-) 918 WP_095010700.1 oligopeptide ABC transporter ATP-binding protein OppF -
  CJZ70_RS14010 (CJZ70_14010) oppD 2640869..2641945 (-) 1077 WP_077670618.1 oligopeptide ABC transporter ATP-binding protein OppD -
  CJZ70_RS14015 (CJZ70_14015) oppC 2641950..2642867 (-) 918 WP_003232954.1 oligopeptide ABC transporter permease OppC -
  CJZ70_RS14020 (CJZ70_14020) oppB 2642871..2643806 (-) 936 WP_014479444.1 oligopeptide ABC transporter permease OppB -
  CJZ70_RS14025 (CJZ70_14025) oppA 2643913..2645550 (-) 1638 WP_014479443.1 oligopeptide ABC transporter substrate-binding protein OppA -

Sequence

Protein


Download         Length: 218 a.a.        Molecular weight: 25749.62 Da        Isoelectric Point: 4.0841

>NTDB_id=242570 CJZ70_RS13980 WP_015383354.1 2635675..2636331(-) (mecA) [Bacillus subtilis strain DKU_NT_02]
MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPLWIQVQALDKGLEIIVTKAQL
SKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQEEKEQKLQFVLRFGDFEDVISLSNLNVNGSKTTLYSFENR
YYLYVDFCNMTDEEVENQLSILLEYATESSISIHRLEEYGKLIISEHALETIKKHFAS

Nucleotide


Download         Length: 657 bp        

>NTDB_id=242570 CJZ70_RS13980 WP_015383354.1 2635675..2636331(-) (mecA) [Bacillus subtilis strain DKU_NT_02]
ATGGAAATTGAAAGAATTAACGAGCATACAGTAAAATTTTATATGTCTTACGGAGATATTGAAGATCGCGGTTTTGACAG
AGAAGAAATTTGGTATAACCGTGAGCGCAGTGAAGAACTTTTCTGGGAAGTCATGGATGAAGTTCATGAAGAAGAGGAAT
TCGCTGTGGAAGGCCCACTTTGGATTCAAGTTCAGGCACTGGACAAAGGATTAGAAATCATCGTCACAAAAGCCCAGCTT
TCCAAAGACGGACAAAAGCTCGAACTGCCGATTCCTGAGGATAAAAAGCAAGAACCAGCATCTGAGGATCTTGACGCCTT
GCTGGATGATTTCCAGAAAGAAGAGCAAGCCGTCAATCAGGAAGAGAAGGAGCAAAAGCTTCAATTTGTCTTGCGATTTG
GCGATTTTGAGGATGTTATTTCTCTATCTAATTTGAACGTTAACGGAAGCAAAACGACTTTATATTCGTTTGAGAACCGA
TATTATTTATATGTAGATTTTTGCAATATGACTGATGAAGAGGTTGAAAATCAGCTAAGCATCCTGCTGGAGTACGCAAC
TGAATCCTCAATCAGCATACACCGTCTTGAAGAGTACGGCAAGCTGATTATTTCAGAGCATGCTCTAGAAACGATAAAAA
AACACTTTGCATCATAG

Domains

Predicted by InterproScan.

Negative regulator of genetic competence (MecA) (MecA)

(1-212)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  mecA Bacillus subtilis subsp. subtilis str. 168

99.541

100

0.995

Multiple sequence alignment