Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | CJO35_RS18120 | Genome accession | NZ_CP022874 |
| Coordinates | 3442693..3442977 (-) | Length | 94 a.a. |
| NCBI ID | WP_073358640.1 | Uniprot ID | - |
| Organism | Bacillus sp. 1s-1 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3398398..3447848 | 3442693..3442977 | within | 0 |
Gene organization within MGE regions
Location: 3398398..3447848
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CJO35_RS22255 | - | 3398398..3400119 (+) | 1722 | WP_021837704.1 | T7SS effector LXG polymorphic toxin | - |
| CJO35_RS17835 (CJO35_17840) | - | 3400137..3400481 (+) | 345 | WP_021837705.1 | hypothetical protein | - |
| CJO35_RS17840 (CJO35_17845) | - | 3400555..3401397 (-) | 843 | WP_021837706.1 | N-acetylmuramoyl-L-alanine amidase | - |
| CJO35_RS17845 (CJO35_17850) | - | 3401449..3401712 (-) | 264 | WP_011198302.1 | phage holin | - |
| CJO35_RS17850 (CJO35_17855) | - | 3401728..3401997 (-) | 270 | WP_009329192.1 | hemolysin XhlA family protein | - |
| CJO35_RS17855 (CJO35_17860) | - | 3402060..3402245 (-) | 186 | WP_003185324.1 | XkdX family protein | - |
| CJO35_RS17860 (CJO35_17865) | - | 3402242..3402565 (-) | 324 | WP_003185326.1 | bZIP transcription factor | - |
| CJO35_RS17865 (CJO35_17870) | - | 3402578..3403915 (-) | 1338 | WP_021837707.1 | phage baseplate upper protein | - |
| CJO35_RS17870 (CJO35_17875) | - | 3403936..3405891 (-) | 1956 | WP_021837708.1 | right-handed parallel beta-helix repeat-containing protein | - |
| CJO35_RS17875 (CJO35_17880) | - | 3405927..3407639 (-) | 1713 | WP_003185331.1 | phage tail protein | - |
| CJO35_RS17880 (CJO35_17885) | - | 3407652..3408488 (-) | 837 | WP_003185333.1 | phage tail family protein | - |
| CJO35_RS17885 (CJO35_17890) | - | 3408485..3412960 (-) | 4476 | WP_021837710.1 | phage tail tape measure protein | - |
| CJO35_RS17890 (CJO35_17895) | - | 3413169..3413531 (-) | 363 | WP_003185339.1 | hypothetical protein | - |
| CJO35_RS17895 (CJO35_17900) | - | 3413585..3414202 (-) | 618 | WP_003185341.1 | major tail protein | - |
| CJO35_RS17900 (CJO35_17905) | - | 3414217..3414600 (-) | 384 | WP_021837711.1 | DUF3168 domain-containing protein | - |
| CJO35_RS17905 (CJO35_17910) | - | 3414597..3414995 (-) | 399 | WP_003185346.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| CJO35_RS17910 (CJO35_17915) | - | 3414995..3415303 (-) | 309 | WP_003185349.1 | phage head closure protein | - |
| CJO35_RS17915 (CJO35_17920) | - | 3415293..3415595 (-) | 303 | WP_021837712.1 | head-tail connector protein | - |
| CJO35_RS17920 (CJO35_17925) | - | 3415616..3416043 (-) | 428 | Protein_3458 | collagen-like protein | - |
| CJO35_RS17925 (CJO35_17930) | - | 3416067..3417350 (-) | 1284 | WP_021837713.1 | phage major capsid protein | - |
| CJO35_RS17930 (CJO35_17935) | - | 3417388..3418119 (-) | 732 | WP_021837714.1 | head maturation protease, ClpP-related | - |
| CJO35_RS17935 (CJO35_17940) | - | 3418064..3419374 (-) | 1311 | WP_021837715.1 | phage portal protein | - |
| CJO35_RS17940 (CJO35_17945) | - | 3419375..3419566 (-) | 192 | WP_021837716.1 | DUF1056 family protein | - |
| CJO35_RS17945 (CJO35_17950) | - | 3419578..3421287 (-) | 1710 | WP_003185362.1 | terminase TerL endonuclease subunit | - |
| CJO35_RS17950 (CJO35_17955) | - | 3421284..3421799 (-) | 516 | WP_003185364.1 | phage terminase small subunit P27 family | - |
| CJO35_RS17960 (CJO35_17965) | - | 3422029..3422403 (-) | 375 | WP_021837717.1 | HNH endonuclease | - |
| CJO35_RS17970 (CJO35_17975) | - | 3422731..3423291 (-) | 561 | WP_021837719.1 | hypothetical protein | - |
| CJO35_RS17975 (CJO35_17980) | - | 3423489..3423716 (-) | 228 | WP_006637236.1 | hypothetical protein | - |
| CJO35_RS17980 (CJO35_17985) | cotD | 3423933..3424157 (-) | 225 | WP_006637235.1 | spore coat protein CotD | - |
| CJO35_RS17990 (CJO35_17995) | - | 3424907..3425287 (-) | 381 | WP_021837721.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| CJO35_RS17995 (CJO35_18000) | - | 3425400..3425777 (-) | 378 | WP_021837723.1 | YopX family protein | - |
| CJO35_RS18000 (CJO35_18005) | - | 3425793..3426308 (-) | 516 | WP_021837724.1 | putative metallopeptidase | - |
| CJO35_RS18005 (CJO35_18010) | fbpA | 3426311..3426481 (-) | 171 | WP_021837725.1 | Fur-regulated basic protein FbpA | - |
| CJO35_RS18010 (CJO35_18015) | - | 3426478..3427017 (-) | 540 | WP_021837726.1 | ERCC4 domain-containing protein | - |
| CJO35_RS18015 (CJO35_18020) | - | 3427014..3427451 (-) | 438 | WP_021837727.1 | hypothetical protein | - |
| CJO35_RS18020 (CJO35_18025) | - | 3427429..3427800 (-) | 372 | WP_021837728.1 | hypothetical protein | - |
| CJO35_RS18025 (CJO35_18030) | - | 3428021..3430453 (-) | 2433 | WP_021837729.1 | phage/plasmid primase, P4 family | - |
| CJO35_RS18030 (CJO35_18035) | - | 3430514..3430951 (-) | 438 | WP_009329263.1 | DUF669 domain-containing protein | - |
| CJO35_RS18035 (CJO35_18040) | - | 3430951..3431883 (-) | 933 | WP_011198320.1 | AAA family ATPase | - |
| CJO35_RS18040 (CJO35_18045) | - | 3431887..3432444 (-) | 558 | WP_021837730.1 | host-nuclease inhibitor Gam family protein | - |
| CJO35_RS18045 (CJO35_18050) | - | 3432537..3432779 (-) | 243 | WP_011198322.1 | hypothetical protein | - |
| CJO35_RS18050 (CJO35_18055) | - | 3432867..3433133 (-) | 267 | WP_021837731.1 | YqaH family protein | - |
| CJO35_RS18055 (CJO35_18060) | - | 3433196..3433525 (+) | 330 | WP_021837732.1 | hypothetical protein | - |
| CJO35_RS21750 | - | 3433522..3433680 (-) | 159 | WP_021837733.1 | hypothetical protein | - |
| CJO35_RS18060 (CJO35_18065) | - | 3433806..3434360 (-) | 555 | WP_003185401.1 | hypothetical protein | - |
| CJO35_RS18065 (CJO35_18070) | - | 3434418..3434606 (-) | 189 | WP_016886536.1 | hypothetical protein | - |
| CJO35_RS18070 (CJO35_18075) | - | 3434738..3434926 (-) | 189 | WP_003185403.1 | helix-turn-helix domain-containing protein | - |
| CJO35_RS18075 (CJO35_18080) | - | 3434923..3435717 (-) | 795 | WP_011198327.1 | ORF6N domain-containing protein | - |
| CJO35_RS18080 (CJO35_18085) | - | 3435741..3435959 (-) | 219 | WP_021837734.1 | helix-turn-helix transcriptional regulator | - |
| CJO35_RS18085 (CJO35_18090) | - | 3436136..3436774 (+) | 639 | WP_003185408.1 | XRE family transcriptional regulator | - |
| CJO35_RS18090 (CJO35_18095) | - | 3436845..3437939 (+) | 1095 | WP_021837735.1 | site-specific integrase | - |
| CJO35_RS18100 (CJO35_18105) | smpB | 3438503..3438976 (-) | 474 | WP_009329604.1 | SsrA-binding protein SmpB | - |
| CJO35_RS18105 (CJO35_18110) | rnr | 3439088..3441391 (-) | 2304 | WP_003185414.1 | ribonuclease R | - |
| CJO35_RS18110 (CJO35_18115) | - | 3441405..3442151 (-) | 747 | WP_003185416.1 | carboxylesterase | - |
| CJO35_RS18115 (CJO35_18120) | secG | 3442292..3442522 (-) | 231 | WP_003185418.1 | preprotein translocase subunit SecG | - |
| CJO35_RS18120 (CJO35_18125) | abrB | 3442693..3442977 (-) | 285 | WP_073358640.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| CJO35_RS18125 (CJO35_18130) | - | 3443006..3443239 (-) | 234 | WP_085959538.1 | helix-turn-helix transcriptional regulator | - |
| CJO35_RS18130 (CJO35_18135) | - | 3443392..3443793 (+) | 402 | WP_009329609.1 | transcriptional regulator | - |
| CJO35_RS18135 (CJO35_18140) | - | 3443963..3444361 (+) | 399 | WP_009329610.1 | helix-turn-helix transcriptional regulator | - |
| CJO35_RS18140 (CJO35_18145) | - | 3444409..3445086 (-) | 678 | WP_003185432.1 | ABC transporter permease | - |
| CJO35_RS18145 (CJO35_18150) | opuCC | 3445103..3446020 (-) | 918 | WP_009329611.1 | osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC | - |
| CJO35_RS18150 (CJO35_18155) | - | 3446034..3446687 (-) | 654 | WP_009329612.1 | ABC transporter permease | - |
| CJO35_RS18155 (CJO35_18160) | - | 3446709..3447848 (-) | 1140 | WP_003185439.1 | betaine/proline/choline family ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10532.45 Da Isoelectric Point: 7.7837
>NTDB_id=242425 CJO35_RS18120 WP_073358640.1 3442693..3442977(-) (abrB) [Bacillus sp. 1s-1]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGCKIVLSPRGAE
MLLEDMMAALSEKK
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGCKIVLSPRGAE
MLLEDMMAALSEKK
Nucleotide
Download Length: 285 bp
>NTDB_id=242425 CJO35_RS18120 WP_073358640.1 3442693..3442977(-) (abrB) [Bacillus sp. 1s-1]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCTGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCTGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
54.945 |
96.809 |
0.532 |