Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CJO35_RS16690 Genome accession   NZ_CP022874
Coordinates   3180305..3180445 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus sp. 1s-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3175305..3185445
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJO35_RS16665 (CJO35_16670) - 3175602..3175991 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  CJO35_RS16670 (CJO35_16675) comA 3176008..3176646 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  CJO35_RS16675 (CJO35_16680) comP 3176733..3179039 (-) 2307 WP_003184851.1 ATP-binding protein Regulator
  CJO35_RS16680 (CJO35_16685) comX 3179062..3179226 (-) 165 WP_003184853.1 competence pheromone ComX -
  CJO35_RS16685 (CJO35_16690) - 3179235..3180116 (-) 882 WP_021837675.1 polyprenyl synthetase family protein -
  CJO35_RS16690 (CJO35_16695) degQ 3180305..3180445 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  CJO35_RS16700 (CJO35_16705) - 3180931..3181278 (+) 348 WP_231105863.1 SDR family oxidoreductase -
  CJO35_RS16705 (CJO35_16710) - 3181321..3182541 (-) 1221 WP_003184864.1 HDOD domain-containing protein -
  CJO35_RS16710 (CJO35_16715) - 3182720..3184189 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  CJO35_RS16715 (CJO35_16720) - 3184207..3184758 (-) 552 WP_003184868.1 isochorismatase family cysteine hydrolase -
  CJO35_RS16720 (CJO35_16725) - 3184943..3185344 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=242422 CJO35_RS16690 WP_003184860.1 3180305..3180445(-) (degQ) [Bacillus sp. 1s-1]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=242422 CJO35_RS16690 WP_003184860.1 3180305..3180445(-) (degQ) [Bacillus sp. 1s-1]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment