Detailed information
Bioinformatically predicted
Overview
| Name | comFC | Type | Machinery gene |
| Locus tag | LBS_RS10375 | Genome accession | NZ_CP022709 |
| Coordinates | 62830..63258 (+) | Length | 142 a.a. |
| NCBI ID | WP_154255254.1 | Uniprot ID | - |
| Organism | Latilactobacillus sakei strain WiKim0063 | ||
| Function | ssDNA transport into the cell (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 39383..90716 | 62830..63258 | within | 0 |
Gene organization within MGE regions
Location: 39383..90716
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LBS_RS00340 (LBS_00340) | - | 40798..41823 (-) | 1026 | WP_025016338.1 | lactonase family protein | - |
| LBS_RS00345 (LBS_00345) | - | 41972..42361 (+) | 390 | WP_049762106.1 | PTS glucitol/sorbitol transporter subunit IIA | - |
| LBS_RS00350 (LBS_00350) | - | 42377..43516 (+) | 1140 | WP_025016337.1 | AI-2E family transporter | - |
| LBS_RS00355 (LBS_00355) | - | 43649..44086 (-) | 438 | WP_025016336.1 | GNAT family N-acetyltransferase | - |
| LBS_RS00360 (LBS_00360) | - | 44250..45227 (-) | 978 | WP_011374185.1 | GMP reductase | - |
| LBS_RS00365 (LBS_00365) | - | 45374..46327 (-) | 954 | WP_011374186.1 | magnesium transporter CorA family protein | - |
| LBS_RS00370 (LBS_00370) | - | 46416..47252 (+) | 837 | WP_016264719.1 | methyltransferase domain-containing protein | - |
| LBS_RS00375 (LBS_00375) | trmL | 47505..48014 (+) | 510 | WP_011374188.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| LBS_RS00380 (LBS_00380) | - | 48026..48433 (+) | 408 | WP_025016334.1 | DUF1149 family protein | - |
| LBS_RS00385 (LBS_00385) | - | 48572..50941 (+) | 2370 | WP_094365641.1 | DNA translocase FtsK | - |
| LBS_RS00390 (LBS_00390) | - | 51139..52410 (+) | 1272 | WP_011374191.1 | pitrilysin family protein | - |
| LBS_RS00395 (LBS_00395) | - | 52400..53704 (+) | 1305 | WP_025016333.1 | pitrilysin family protein | - |
| LBS_RS00400 (LBS_00400) | - | 53704..54435 (+) | 732 | WP_025016332.1 | SDR family oxidoreductase | - |
| LBS_RS00405 (LBS_00405) | - | 54517..55440 (+) | 924 | WP_011374194.1 | RodZ domain-containing protein | - |
| LBS_RS00410 (LBS_00410) | pgsA | 55466..56050 (+) | 585 | WP_011374195.1 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | - |
| LBS_RS00415 (LBS_00415) | recA | 56233..57300 (+) | 1068 | WP_011374196.1 | recombinase RecA | Machinery gene |
| LBS_RS00420 (LBS_00420) | rny | 57687..59252 (+) | 1566 | WP_011374197.1 | ribonuclease Y | - |
| LBS_RS00425 (LBS_00425) | - | 59408..60496 (+) | 1089 | WP_035144637.1 | MraY family glycosyltransferase | - |
| LBS_RS00430 (LBS_00430) | - | 60523..61188 (-) | 666 | WP_025016329.1 | YigZ family protein | - |
| LBS_RS00435 (LBS_00435) | comFA | 61250..62587 (+) | 1338 | WP_052039239.1 | DEAD/DEAH box helicase | Machinery gene |
| LBS_RS10375 | comFC | 62830..63258 (+) | 429 | WP_154255254.1 | ComF family protein | Machinery gene |
| LBS_RS00445 (LBS_00445) | raiA | 63385..63930 (+) | 546 | WP_011374202.1 | ribosome-associated translation inhibitor RaiA | - |
| LBS_RS00450 (LBS_00450) | secA | 64179..66542 (+) | 2364 | WP_011374203.1 | preprotein translocase subunit SecA | - |
| LBS_RS00455 (LBS_00455) | prfB | 66612..67728 (+) | 1117 | WP_099049013.1 | peptide chain release factor 2 | - |
| LBS_RS00460 (LBS_00460) | ftsE | 67859..68545 (+) | 687 | WP_011374205.1 | cell division ATP-binding protein FtsE | - |
| LBS_RS00465 (LBS_00465) | ftsX | 68535..69422 (+) | 888 | WP_016264727.1 | permease-like cell division protein FtsX | - |
| LBS_RS00470 (LBS_00470) | - | 69616..70749 (+) | 1134 | WP_094365643.1 | PDZ domain-containing protein | - |
| LBS_RS00475 (LBS_00475) | - | 70769..71482 (+) | 714 | WP_094365644.1 | response regulator transcription factor | - |
| LBS_RS00480 (LBS_00480) | pnpS | 71469..73130 (+) | 1662 | WP_094365645.1 | two-component system histidine kinase PnpS | - |
| LBS_RS00485 (LBS_00485) | - | 73223..74083 (+) | 861 | WP_011374210.1 | phosphate ABC transporter substrate-binding protein PstS family protein | - |
| LBS_RS00490 (LBS_00490) | pstC | 74093..75016 (+) | 924 | WP_011374211.1 | phosphate ABC transporter permease subunit PstC | - |
| LBS_RS00495 (LBS_00495) | pstA | 75016..75900 (+) | 885 | WP_016264731.1 | phosphate ABC transporter permease PstA | - |
| LBS_RS00500 (LBS_00500) | pstB | 75910..76719 (+) | 810 | WP_011374213.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| LBS_RS00505 (LBS_00505) | pstB | 76740..77498 (+) | 759 | WP_011374214.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| LBS_RS00510 (LBS_00510) | phoU | 77515..78192 (+) | 678 | WP_011374215.1 | phosphate signaling complex protein PhoU | - |
| LBS_RS00520 (LBS_00520) | - | 78411..79340 (+) | 930 | WP_094365647.1 | IS30-like element ISLpl1 family transposase | - |
| LBS_RS00525 (LBS_00525) | - | 79453..79923 (+) | 471 | WP_094365648.1 | nucleoside 2-deoxyribosyltransferase | - |
| LBS_RS00530 (LBS_00530) | - | 80113..81300 (+) | 1188 | WP_094365649.1 | glycine C-acetyltransferase | - |
| LBS_RS00535 (LBS_00535) | - | 81320..82267 (+) | 948 | WP_094365650.1 | L-threonine 3-dehydrogenase | - |
| LBS_RS00540 (LBS_00540) | liaX | 82454..83935 (+) | 1482 | WP_094365651.1 | daptomycin-sensing surface protein LiaX | - |
| LBS_RS00545 (LBS_00545) | - | 83963..84199 (+) | 237 | WP_016264736.1 | PspC domain-containing protein | - |
| LBS_RS00550 (LBS_00550) | - | 84199..84474 (+) | 276 | WP_094365652.1 | hypothetical protein | - |
| LBS_RS00555 (LBS_00555) | - | 84474..84848 (+) | 375 | WP_025016320.1 | phage holin family protein | - |
| LBS_RS00560 (LBS_00560) | hprK | 84986..85927 (+) | 942 | WP_016264738.1 | HPr(Ser) kinase/phosphatase | - |
| LBS_RS00565 (LBS_00565) | lgt | 86055..86882 (+) | 828 | WP_025016319.1 | prolipoprotein diacylglyceryl transferase | - |
| LBS_RS00570 (LBS_00570) | - | 86900..87922 (+) | 1023 | WP_016264740.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| LBS_RS00575 (LBS_00575) | - | 88138..88440 (+) | 303 | WP_226474476.1 | hypothetical protein | - |
| LBS_RS00580 (LBS_00580) | trxB | 88557..89477 (+) | 921 | WP_016264742.1 | thioredoxin-disulfide reductase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16678.13 Da Isoelectric Point: 10.0721
>NTDB_id=241815 LBS_RS10375 WP_154255254.1 62830..63258(+) (comFC) [Latilactobacillus sakei strain WiKim0063]
MQLYFQRYKGQGDYQLRLLFERDIRTRFPVKSNVTYVPIPSDEQHQQERGFNPVQGLFETCFPLTSLLKKRPTEKGQAQK
NRAERLASSQFFELIPQELPHKPQSIIILDDIYTTGRTVWHAQQCLRARYPQIAINAITLAR
MQLYFQRYKGQGDYQLRLLFERDIRTRFPVKSNVTYVPIPSDEQHQQERGFNPVQGLFETCFPLTSLLKKRPTEKGQAQK
NRAERLASSQFFELIPQELPHKPQSIIILDDIYTTGRTVWHAQQCLRARYPQIAINAITLAR
Nucleotide
Download Length: 429 bp
>NTDB_id=241815 LBS_RS10375 WP_154255254.1 62830..63258(+) (comFC) [Latilactobacillus sakei strain WiKim0063]
ATGCAGTTATATTTTCAACGTTATAAGGGCCAAGGAGACTATCAATTACGGCTATTATTCGAACGCGACATTCGAACTCG
GTTTCCAGTAAAATCCAATGTAACTTACGTGCCTATTCCATCTGATGAGCAACATCAACAAGAACGGGGCTTTAATCCAG
TCCAAGGCTTATTCGAAACTTGTTTTCCGTTAACATCGCTATTGAAAAAGCGGCCAACAGAGAAGGGCCAAGCACAAAAA
AATCGTGCAGAACGTCTTGCAAGTTCACAATTTTTTGAATTAATACCGCAAGAATTACCGCATAAGCCACAATCGATAAT
AATCTTGGATGATATTTATACGACGGGCCGAACGGTGTGGCATGCACAACAATGTCTGCGTGCTCGGTATCCACAAATTG
CAATTAATGCGATTACTTTAGCCAGATAG
ATGCAGTTATATTTTCAACGTTATAAGGGCCAAGGAGACTATCAATTACGGCTATTATTCGAACGCGACATTCGAACTCG
GTTTCCAGTAAAATCCAATGTAACTTACGTGCCTATTCCATCTGATGAGCAACATCAACAAGAACGGGGCTTTAATCCAG
TCCAAGGCTTATTCGAAACTTGTTTTCCGTTAACATCGCTATTGAAAAAGCGGCCAACAGAGAAGGGCCAAGCACAAAAA
AATCGTGCAGAACGTCTTGCAAGTTCACAATTTTTTGAATTAATACCGCAAGAATTACCGCATAAGCCACAATCGATAAT
AATCTTGGATGATATTTATACGACGGGCCGAACGGTGTGGCATGCACAACAATGTCTGCGTGCTCGGTATCCACAAATTG
CAATTAATGCGATTACTTTAGCCAGATAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comFC | Latilactobacillus sakei subsp. sakei 23K |
95.775 |
100 |
0.958 |
| comFC | Lactococcus lactis subsp. cremoris KW2 |
38.028 |
100 |
0.38 |